KEGG   Bacillus subtilis QB928: B657_10350Help
Entry
B657_10350        CDS       T02292                                 

Gene name
yhfS
Definition
(GenBank) Putative acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsq  Bacillus subtilis QB928
Pathway
bsq00071  Fatty acid degradation
bsq00072  Synthesis and degradation of ketone bodies
bsq00280  Valine, leucine and isoleucine degradation
bsq00310  Lysine degradation
bsq00362  Benzoate degradation
bsq00380  Tryptophan metabolism
bsq00620  Pyruvate metabolism
bsq00630  Glyoxylate and dicarboxylate metabolism
bsq00640  Propanoate metabolism
bsq00650  Butanoate metabolism
bsq00900  Terpenoid backbone biosynthesis
bsq01100  Metabolic pathways
bsq01110  Biosynthesis of secondary metabolites
bsq01120  Microbial metabolism in diverse environments
bsq01130  Biosynthesis of antibiotics
bsq01200  Carbon metabolism
bsq01212  Fatty acid metabolism
bsq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsq00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B657_10350 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    B657_10350 (yhfS)
   00640 Propanoate metabolism
    B657_10350 (yhfS)
   00650 Butanoate metabolism
    B657_10350 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    B657_10350 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    B657_10350 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    B657_10350 (yhfS)
   00310 Lysine degradation
    B657_10350 (yhfS)
   00380 Tryptophan metabolism
    B657_10350 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    B657_10350 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    B657_10350 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B657_10350 (yhfS)
Enzymes [BR:bsq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     B657_10350 (yhfS)
Exosome [BR:bsq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   B657_10350 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFQ56951
Position
complement(1088884..1089978)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQVDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDEGFYREEVVALGE
LETDEAFLKTRPIEAIIPRAKPVFDTSSGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNFPPAAPVVAIRQLLHTHDVTPDDIDLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRPDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacggactgctg
aagcccttcctgccggaggatttggcggctcccatcatccgctgtctcagccgaaagcta
gaggatcaagttgacgaggtcattctcggaaacgctactggcagaggcggcaacctggcc
agactgtcagcccttcaagccggactgcctttatcggttcccggaatgacaattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gctcgcttttctccagatgcgatcggcgatccagacatgggcattgcggcagaatatacg
gctgcacgctattccatcagcagaagcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcgcatgatgaaggattttaccgtgaagaagttgttgctctcggggaa
ttggagacggacgaagcatttttgaaaacgcggccaatagaagcgattattccccgtgca
aagccggttttcgacaccagctccggaacagtcacagcagccaacagcagtggcatagca
gacggagcagccgctcttttggtaatggaagaagaaaaagcagcagccctgggacttaag
cctgtgcttcggtttatcggcagcgctgtcagcggcattcaccccaactttccgcccgcg
gcaccggttgtcgcgattcgtcagctcttacatacacacgatgtaacacctgatgatatc
gatttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgccttagctcttggccatccgtac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggccagac
tgtcaatatgctgttgcagccatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system