KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0049Help
Entry
I33_0049          CDS       T01837                                 

Gene name
metG
Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00450  Selenocompound metabolism
bsr00970  Aminoacyl-tRNA biosynthesis
bsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    I33_0049 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    I33_0049 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bsr01007]
    I33_0049 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bsr03016]
    I33_0049 (metG)
Enzymes [BR:bsr01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     I33_0049 (metG)
Amino acid related enzymes [BR:bsr01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   I33_0049 (metG)
Transfer RNA biogenesis [BR:bsr03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    I33_0049 (metG)
 Prokaryotic type
   Other AARSs
    I33_0049 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA_bind tRNA-synt_1e Anticodon_1 tRNA-synt_1f ARL2_Bind_BART
Motif
Other DBs
NCBI-ProteinID: AEP89109
Position
45490..47484
Genome map
AA seq 664 aa AA seqDB search
MPQENNTFYITTPIYYPSGKLHIGHAYTTVAGDAMARYKRLKGFDVRYLTGTDEHGQKIQ
QKAEQENITPQEYVDRAASDIQKLWKQLEISNDDFIRTTEKRHKVVIEKVFQKLLDNGDI
YLDEYEGWYSIPDETFYTETQLVDIERNEKGEVIGGKSPDSGHPVELIKEESYFFRMGKY
ADRLLKYYEENPTFIQPESRKNEMINNFIKPGLEDLAVSRTTFDWGVKVPENPKHVVYVW
IDALFNYLTALGYDTENDELYQKYWPADVHLVGKEIVRFHTIYWPIMLMALDLPLPKQVF
AHGWLLMKDGKMSKSKGNVVDPVTLIERYGLDELRYYLLREVPFGSDGVFTPEGFVERIN
YDLANDLGNLLNRTVAMINKYFDGQIGSYKGAVTEFDQTLTSVAEETVKAYEKAMENMEF
SVALSTLWQLISRTNKYIDETAPWVLAKDPAKEEELRSVMYHLAESLRISAVLLQPFLTK
TPEKMFEQLGITDESLKAWDSITTFGQLKDTKVQKGEPLFPRLEAEEEIAYIKGKMQGSA
PAKEETKEEEPQEVDRLPEITIDQFMDVELRVAEVIEAEPVKKADRLLKLQLDLGFEKRQ
VVSGIAKHYTPEELVGKKLVCVTNLKPVKLRGELSQGMILAGEADGVLKVVSIDQSLPKG
TRIK
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaagaaaacaatacattttacattacaacaccgatttattatccgagcggaaaa
ttacatatcggccatgcatatacgacagtcgcgggagatgcaatggcacgttacaaaaga
ttaaaagggttcgatgttcgctatttaacgggaacggacgagcatggacaaaagatccag
caaaaagctgaacaggaaaacattacacctcaggagtatgtggatcgcgcagcatcagat
attcaaaaactgtggaagcagcttgaaatctcaaacgacgactttatccgcacgacagaa
aaacggcataaagttgtcattgaaaaggtgtttcaaaagcttcttgataacggggacatc
tatcttgatgagtatgaaggctggtacagcattcctgatgaaacgttctacacggaaact
cagctcgttgatattgagcggaatgaaaagggagaggtcatcggcggaaaaagccctgac
agcggtcacccagttgaattgatcaaagaggaatcttatttcttccgcatggggaaatac
gcggatcgtcttctgaaatactatgaagaaaacccaacattcattcagccagaatcacgc
aaaaacgaaatgattaataactttatcaagcctggacttgaggatctggcagtatcacgc
accacttttgattggggcgtgaaggtgccggaaaatccaaagcatgttgtatatgtttgg
attgacgcactatttaactatttaacagcactcggttatgatacagaaaatgatgagctt
tatcaaaaatattggcctgccgatgttcatttagtcggtaaggagattgtacgattccat
actatttactggccaattatgctgatggcgctggatcttccgctgccaaagcaagtattc
gcgcatggctggcttttgatgaaagacggaaaaatgtcgaaatcaaaaggaaacgttgta
gatccggttacattaattgaacgctatggtttagacgaacttcgctattacctgcttcgt
gaagtgccgttcggatctgacggtgttttcacgccggaaggatttgttgagcgaatcaac
tatgatttagcgaatgatttaggaaatctattgaatcgtactgttgcgatgatcaataag
tattttgacggacaaattggttcttacaaaggtgctgttacggaatttgaccaaacgctc
acttctgttgctgaagaaacagtgaaagcttatgagaaagcaatggaaaatatggagttc
tcggtagcactttcgactttatggcagctcatcagccgcacaaacaaatacattgatgag
acagctccatgggtgcttgcgaaagatccggcaaaagaagaagaattgcgatcagttatg
tatcatctcgctgaatcattgcgtatttcagcggtactgcttcagccattcttaacaaaa
acacctgaaaaaatgttcgagcagctgggcattactgatgaatctttaaaagcttgggac
agcattacaactttcggccagctgaaagatacaaaagtacaaaaaggcgagccattgttc
cctcgtttagaggcagaagaagaaattgcttacatcaaagggaaaatgcaaggttcggca
ccagcgaaagaagaaacaaaagaagaagagccgcaagaggtcgatcgtttacctgaaatt
acgattgatcaattcatggatgtagagcttcgcgtagctgaggtcattgaggcagagcca
gtgaaaaaagcagaccgtttattgaagctgcagcttgatcttggttttgaaaagcgccaa
gtggtatccggtattgcgaagcattatacgcctgaagagcttgttggaaaaaaactcgtt
tgtgtaacaaatctaaaaccggttaaactcagaggagagctttctcaaggtatgatcctt
gcaggagaagcagatggcgttttaaaggtcgtgtctattgatcagtcgttaccaaaaggc
acaagaattaaataa

DBGET integrated database retrieval system