KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0057Help
Entry
I33_0057          CDS       T01837                                 

Gene name
ispE
Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00900  Terpenoid backbone biosynthesis
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01130  Biosynthesis of antibiotics
Module
bsr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I33_0057 (ispE)
Enzymes [BR:bsr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     I33_0057 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEP89117
Position
53374..54243
Genome map
AA seq 289 aa AA seqDB search
MRILEKAPAKINLSLDVTRKRPDGYHEVEMIMTTIDLADRIELTELAEDEVRVSSHNRFV
PDDQRNLAYQAAKLIKDRYNVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLWNLN
LSAETLAELGAEIGSDVSFCVYGGTALATGRGEKIKHISTPPHCWVILAKPTIGVSTAEV
YRALKLDGIEHPDVQGMIEAIEEKSFQKMCSRLGNVLESVTLDMHPEVAMIKNQMKRFGA
DAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgcgtattttagaaaaagcgccagctaagatcaatctgtcacttgacgtcacccgaaaa
cgcccggatggctatcatgaagtcgaaatgatcatgacgacaattgatttagctgatcga
attgaattgacggagcttgcagaggatgaagtgagggtttcctcccacaaccgatttgtg
cctgatgaccaaagaaacttagcttatcaggctgccaagctgatcaaggacagatacaac
gtgaaaaagggagtttccatcatgattacgaaggtaattccggtggctgccggtcttgcc
ggcggaagcagtgatgcggcggcgacgctcagagggctgaacagactgtggaatttaaat
ctttctgcggaaacgcttgccgagcttggagcggaaattggctctgacgtttcattttgt
gtctatggcggaactgcactagcaacagggcgcggcgagaaaattaaacatatcagcaca
cctccgcactgctgggtcattttagcgaagccgactatcggtgtttcaacagctgaagtg
tacagagcactgaaactggatggtatagagcatcccgatgtacaaggcatgatcgaggcg
atagaagaaaagagttttcagaagatgtgcagccgtttaggcaatgtgcttgaatctgtt
acgctcgatatgcatcctgaagttgcgatgatcaaaaaccagatgaaacgctttggtgca
gatgccgtgttaatgagcgggagcggcccgacagtatttggactggttcagtatgagtcg
aaggtgcagagaatttataacgggttaagaggcttctgcgatcaagtttatgcggtgaga
atgatcggcgaacagaacgctcttgattaa

DBGET integrated database retrieval system