KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0150Help
Entry
I33_0150          CDS       T01837                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    I33_0150 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:bsr03011]
    I33_0150 (rplV)
Ribosome [BR:bsr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    I33_0150 (rplV)
  Bacteria
    I33_0150 (rplV)
  Archaea
    I33_0150 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AEP89191
Structure
PDB: 

Position
138359..138700
Genome map
AA seq 113 aa AA seqDB search
MQAKAVARTVRIAPRKARLVMDLIRGKQVGEAVSILNLTPRAASPIIEKVLKSAIANAEH
NYEMDANNLVISQAFVDEGPTLKRFRPRAMGRASQINKRTSHITIVVSEKKEG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcaagctaaagctgttgcaagaacagtccgtattgctcctcgtaaagcacgtctagta
atggacctgattcgaggcaagcaagtaggtgaggcagtatcaatcttgaaccttacacca
agagctgcttctccaattattgaaaaagtattaaaatccgctatcgcaaatgctgagcat
aactatgaaatggacgctaacaacctggttatttctcaagcattcgttgacgaaggccct
acgttaaaaagattccgcccacgtgctatgggacgtgcgagccaaatcaacaaacgtacg
agccacattacaatcgttgtatcagaaaagaaggagggataa

DBGET integrated database retrieval system