KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_0804Help
Entry
I33_0804          CDS       T01837                                 

Definition
(GenBank) putative glucosidase LplD
  KO
K07406  alpha-galactosidase [EC:3.2.1.22]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00052  Galactose metabolism
bsr00561  Glycerolipid metabolism
bsr00600  Sphingolipid metabolism
bsr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    I33_0804
  Lipid metabolism
   00561 Glycerolipid metabolism
    I33_0804
   00600 Sphingolipid metabolism
    I33_0804
Enzymes [BR:bsr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     I33_0804
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_4 Glyco_hydro_4C Ldh_1_N
Motif
Other DBs
NCBI-ProteinID: AEP89800
Structure
PDB: 

Position
760476..761816
Genome map
AA seq 446 aa AA seqDB search
MFHISTLDQIKIAYIGGGSQGWARSLMSDLSIDERMSGTVALYDLDFEAAQKNEVIGNHS
GNRRWRYEAVSTLKKALSAADIVIISILPGSLDDMEVDVHLPERCGIYQSVGDTVGPGGI
IRGLRAVPIFAEIARAIRDYAPESWVINYTNPMSVCTRVLYKVFPGIKAIGCCHEVFGTQ
KLLAEMVTERLGIEVPRREDIRVNVLGINHFTWITTASYRHIDLLPIFREFSAHYGESGY
ELEGESWRDSVFCSAHRVAFDLFETYGAIPAAGDRHLAEFLPGPYLKQPEVWKFHLTPIS
FRKQDRAEKRQQTERLIVQQRGVAGKTSGEEGVNIIAALLGLGELVTNVNMPNQGQVSNL
PIQAIVETNAFITKNGVQPIFSGALPKGVEMLAARHISNQEAVAEAGLTKDTGLAFQAFL
NDPLVQIDRSDAEQLFNDMLQCTMQR
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcatatcagtacattagatcagattaagattgcctatatcggcggggggtcccaa
ggctgggccagaagcctgatgagtgatttgtcgattgatgaacggatgtcaggcacggtg
gcgctctatgatcttgattttgaagccgctcagaaaaatgaagtgatcggcaatcacagc
gggaaccgcagatggagatatgaggctgtttctactttgaaaaaggcgttatcagccgct
gatatcgttattatttccattttgccgggatcactggatgatatggaagtcgatgtccac
ttgcctgagcgctgcggtatttatcagtctgtaggtgatactgtcgggcctggagggatc
atcagaggcttgcgtgctgtgccgatatttgcggaaattgcccgggcaataagagactac
gcacctgaatcatgggtcattaattatacaaacccgatgtctgtctgtacaagagtgctg
tataaagtgtttcccggcatcaaagcgattggctgctgccacgaggtattcgggacgcaa
aagctattggcggaaatggtcacggaaaggctggggatagaggtgccgcggcgtgaagat
atccgcgttaatgtgctcggcattaaccattttacatggatcacaacagcctcttaccgc
catattgacctgctgcctatattccgtgaattcagcgcgcactatggagaatcaggatat
gagctggagggggaaagctggagggacagcgtcttttgttcggcacaccgtgttgcgttt
gatttatttgaaacgtatggcgccatccctgctgcgggtgacaggcatctggcagagttt
cttcccggcccatacctcaaacagcctgaggtatggaaatttcatctcacacctatatca
ttcagaaaacaagacagagctgagaaacgacaacaaacagaacggttgatcgtgcaacaa
cggggcgttgcaggaaaaacttcgggagaagaaggcgtgaacattatagcggctcttctc
ggattgggtgaactcgtcacaaatgtaaatatgccgaatcaaggccaggtctcaaacctt
cctatacaagccattgttgaaacaaacgcattcatcacaaagaacggtgtccagccgatt
ttttccggagcgcttccgaaaggtgtggaaatgctggcggctaggcatatatcgaatcaa
gaggcagtggcggaagccggtttaacaaaggatactggcctcgcgtttcaagctttcctc
aatgacccgcttgtccagattgaccgcagtgatgcagagcagcttttcaatgacatgctc
caatgcaccatgcaacgttga

DBGET integrated database retrieval system