KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1168Help
Entry
I33_1168          CDS       T01837                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00071  Fatty acid degradation
bsr00072  Synthesis and degradation of ketone bodies
bsr00280  Valine, leucine and isoleucine degradation
bsr00310  Lysine degradation
bsr00362  Benzoate degradation
bsr00380  Tryptophan metabolism
bsr00620  Pyruvate metabolism
bsr00630  Glyoxylate and dicarboxylate metabolism
bsr00640  Propanoate metabolism
bsr00650  Butanoate metabolism
bsr00900  Terpenoid backbone biosynthesis
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01130  Biosynthesis of antibiotics
bsr01200  Carbon metabolism
bsr01212  Fatty acid metabolism
bsr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    I33_1168
   00630 Glyoxylate and dicarboxylate metabolism
    I33_1168
   00640 Propanoate metabolism
    I33_1168
   00650 Butanoate metabolism
    I33_1168
  09103 Lipid metabolism
   00071 Fatty acid degradation
    I33_1168
   00072 Synthesis and degradation of ketone bodies
    I33_1168
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    I33_1168
   00310 Lysine degradation
    I33_1168
   00380 Tryptophan metabolism
    I33_1168
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I33_1168
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    I33_1168
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    I33_1168
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsr04147]
    I33_1168
Enzymes [BR:bsr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     I33_1168
Exosome [BR:bsr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   I33_1168
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEP90139
Position
complement(1088096..1089190)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGNQNGLLKPFLPEDLAAPIIRCLSRKLEDQIDEVILGNATGRGGNLA
RLSALQARLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSQSPFSER
ARFSPDAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDEGFYREEIVALGE
LETDEAFLKTRPIEAIIPRAKPVFDTSAGTVTAANSSGIADGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRQLLHTHDVTPDDIGLFEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYEAKRRTDCQYAVAAIGSGGGIGLALLF
EVLV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcggttattgttgatgcaaaacgaacgatctttggaaatcaaaacgggctgctg
aagcccttcctgccggaggatttggcagctcctatcatccgctgtctcagccgaaagcta
gaggatcaaattgacgaggttattctcggaaatgctaccggcagaggcggcaacctcgcc
agactgtcagcccttcaagccagactgcctttatcagttcccggaatgacaattgacaga
cagtgcggctccggacttgaagctgtgcgctatgcctgcagccttattcaagcgggagcc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcccctttttcagaacgg
gcccgcttttctccagatgcgatcggcgatccagacatgggcatcgcagcagaatatacg
gcggcacgctattccatcagccgaagcatgcaggatgagtacgcgcttctcagccatcaa
cgcagcaggaacgcccatgatgaaggattttaccgtgaagaaattgttgctctcggggaa
ttggagacagacgaagcatttttgaaaacgcggccgatagaagcgattattccccgcgca
aagccggttttcgacaccagcgccggaacagtcacagcagccaacagcagcggcatagca
gacggagcagcggctcttttagtaatggaagaagaaaaagcggcagccctgggacttaag
cctgtgctccggtttatcggcagcgcagtcagcggtattcaccccaactatccgcccgcg
gcaccggttgatgcgatccgtcagctcttacatacacacgatgtaacacctgatgatatc
ggtttatttgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcattcccttttcaaaaatcaatgtgcgcggcggcgcattagctcttggccatccatac
ggtgcatcaggtgcagctctggtaaccagattgttttatgaagcgaaaagacggacagac
tgtcaatatgctgttgctgccatcggaagcggcggcggaatcgggctggctttattattt
gaagttcttgtatag

DBGET integrated database retrieval system