KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1376Help
Entry
I33_1376          CDS       T01837                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00860  Porphyrin and chlorophyll metabolism
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    I33_1376
Enzymes [BR:bsr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     I33_1376
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Oxidored_nitro DEDD_Tnp_IS110
Motif
Other DBs
NCBI-ProteinID: AEP90345
Position
1271136..1271951
Genome map
AA seq 271 aa AA seqDB search
MGKGLHGKRVVIGGSRKTEEISTIIEKQGGTPVIRPLQGTVYLAEKQVEPDLRTFVEGKK
ADWVIFTTGIGLETLVDMAEKIGLKEEFLQAIRQAKAACRGYKTLSALKKLGITPEASDE
DGTTRGLIRSLEPHDFSGKTVMVQLHGEKAPALIAFLEEKGASVVPILPYQHIPPEEETV
ERLCRELMNGEIDAVCFTTAIQVRSLFDFAKRRGYINEVKKVFKERAIAAAVGKVTAEAL
REEGITRLLAPEIERMGAMIVELAKYYEEKE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaaggattacatggaaagcgcgtggtgatcgggggctcccgaaaaaccgaagaa
atcagcaccatcattgaaaaacagggcggaactcctgtcatccgtcctctccaaggaacg
gtttacttagcagagaagcaggtggagccggatttgcggacgtttgtggagggaaaaaaa
gctgactgggtcattttcacgacaggcatcgggttggagactcttgtcgatatggcagag
aaaatcggtctgaaagaagagtttctgcaggcgattcgtcaggcaaaagcggcatgcagg
gggtacaaaacgctgtctgcgctgaaaaagcttgggatcacaccggaagcttcggatgaa
gacgggacaacaagaggcttaatccgttctttggagcctcacgacttttcaggaaaaaca
gtcatggtgcagcttcatggagaaaaagcgccggctctcatcgcatttcttgaagaaaaa
ggcgcgtctgtcgtgccgattctgccttatcagcacatcccgccggaggaggaaacggtg
gagcggttatgccgagagctgatgaacggtgagatcgatgccgtttgttttacaacggcc
attcaggttcgttccctgtttgattttgctaagaggcgaggttatatcaatgaagtgaag
aaggtattcaaagaacgcgccatcgcagctgctgtcggaaaagtgactgctgaagcactg
cgggaagagggcattacgagactgcttgcgccagagattgagcggatgggtgcgatgatt
gttgagctggccaagtattatgaagaaaaggaataa

DBGET integrated database retrieval system