KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_1842Help
Entry
I33_1842          CDS       T01837                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00900  Terpenoid backbone biosynthesis
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01130  Biosynthesis of antibiotics
Module
bsr_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    I33_1842 (dxr)
Enzymes [BR:bsr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     I33_1842 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_redisom_C DXP_reductoisom DXPR_C Semialdhyde_dh Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AEP90808
Position
1697352..1698503
Genome map
AA seq 383 aa AA seqDB search
MKNICLLGATGSIGEQTLDVLRAHQDQFQLVSMSFGRNIDKAVPMIEVFQPKFVSVGDLD
TYHKLKQMSFSFECQIGLGEEGLIEAAVMEEVDIVVNALLGSVGLIPTLKAIEQKKTIAL
ANKETLVTAGHIVKEHAKKYDVPLLPVDSEHSAIFQALQGEQAKNIERLIITASGGSFRD
KTREELESVTVEDALKHPNWSMGAKITIDSATMMNKGLEVIEAHWLFDIPYEQIDVVLHK
ESIIHSMVEFHDKSVIAQLGTPDMRVPIQYALTYPDRLPLPDAKRLELWEIGSLHFEKAD
FDRFRCLQFAFESGKIGGTMPTVLNAANEVAVAAFLAGKIPFLAIEDCIEKALTRHQLLK
KPSLADIQEVDKDTRGYVNSILT
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaatatttgtcttttaggagcaacaggatcaatcggcgaacagactcttgatgta
ctacgtgcacatcaagatcaatttcagctggtatctatgtcgtttggcagaaatattgat
aaggccgttccaatgattgaggtctttcagccgaagtttgtctctgtcggtgatctggat
acatatcataaattaaaacaaatgtctttttcttttgaatgccaaattgggctgggagaa
gaaggactgatagaagcagcagtgatggaggaggttgacattgttgtcaacgctttgctt
ggaagcgtcggtcttatcccgacgttaaaggcaattgaacagaaaaaaacaattgcgctt
gcaaataaggaaactcttgtcactgcagggcatatagtaaaagaacatgctaagaaatat
gatgttccgctgctgcctgttgacagtgagcattcagccatttttcaagctcttcaaggc
gaacaggctaaaaacattgaacgcctcatcattacggcatccggcggaagttttcgggac
aagacgcgggaggagctcgaatcagtaacagttgaagatgcattaaaacatccaaactgg
tcaatgggtgcaaaaattacaattgattcggctacaatgatgaataagggattagaggtg
atcgaggcacactggcttttcgatataccttatgaacaaattgatgtggttttacataag
gagagcatcatccattcaatggttgagttccatgataaaagtgtgattgcgcagctcgga
actccggatatgagagtccccattcaatatgcgctcacttatcctgaccgattgccatta
ccagatgcgaaaaggcttgaattatgggaaatcggcagccttcattttgagaaagctgat
tttgacaggttccgatgcttacaatttgcttttgaatcaggtaaaataggaggaacaatg
ccgacagtcctaaatgcggcaaatgaagtagctgtcgctgcctttttagctggcaagata
ccgtttttggctattgaagactgtatcgaaaaggcactaacccgccatcaattactgaaa
aaaccgagcctggcggacattcaagaagtggacaaagatacccggggatacgtcaattca
atactcacataa

DBGET integrated database retrieval system