KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3008Help
Entry
I33_3008          CDS       T01837                                 

Definition
(GenBank) AMP-binding enzyme family protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00010  Glycolysis / Gluconeogenesis
bsr00620  Pyruvate metabolism
bsr00640  Propanoate metabolism
bsr00680  Methane metabolism
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01130  Biosynthesis of antibiotics
bsr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_3008
   00620 Pyruvate metabolism
    I33_3008
   00640 Propanoate metabolism
    I33_3008
  Energy metabolism
   00680 Methane metabolism
    I33_3008
Enzymes [BR:bsr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     I33_3008
Lipid biosynthesis proteins [BR:bsr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   I33_3008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEP91951
Position
complement(2814452..2816041)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQESWSYEKLMEETNKIGAVLA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLITLSIGENDAGWKNLLSIEADGSQFKTADTTRDDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRFDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDTPIKPGSMGKPTPGNQVEIINEDGEIC
KPGEVGDIAVHLSTPALFKEYFKDPERMKTQIRGDYFLTGDRARKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKML
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgtgaagatttaattgcccctatgcaatataatttagtgaatgaaatggaa
aagttcagtgccgctggacaaaaaaccgctcttctgtgggaggatgagtcgggcaagcaa
gaatcttggtcgtatgaaaagctgatggaagaaacaaataaaatcggagctgtcttagct
gatcttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgcttgaagcc
tatgctgtttatttagctatcctgaaatcaggaatggttgtgattccgtgctccgaaatg
cttcgcgcgaaagatcttgaataccggattgaacatgcagaggtaaaaggcgccatcgtc
tactccgaatttatcggggctttccgggatgtcagtacggctgacaaactgattacactg
tctattggtgaaaatgatgccggctggaaaaacctcttatcaattgaagcggacggaagc
caatttaaaacagctgacacaacaagagatgatatggctttcttatcttatacatccgga
acaacaggtcagccgaaaggtgttgtacatacacatggatgggcatttgctcatttaaaa
acttctgccggcgcttggcttgatatttctgaaaaggatatcgtctgggcaactgctgcc
cctggctggcaaaagtgggtgtggagtccgtttttagcggtgcttggcagcggagcaacc
ggttttgtgtaccacggcagattcaaagcagaaaaatatctagagcttttaaatcgctac
aaaatcaatgttttctgctgcacgccgacagaataccgcttaatggcgaaggtcgagggc
ttggaccgctttgatctttctgccctgcacagcgctgtttccgcaggtgagccgctcaac
cgtgaagtcattgatgttttccaaaagcactttggcattaaggtacgggacggatatggc
caaacagaaagcacgcttttggttggtgttttgaaagatacgcctattaaaccgggaagc
atgggaaaaccgacaccgggaaatcaggtggagatcataaatgaagacggtgaaatctgc
aaacctggtgaggttggcgatatcgctgttcacctcagtacgcctgcgctctttaaagag
tattttaaagatccggaaagaatgaaaacacaaattcgcggcgattatttcctaacggga
gacagagcaagaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatt
attatcagctccggctacacgattgggcctttcgaggtggaagacgcacttgttaagcac
ccagaagtaaaagaatgtgctgttgtcgcaagccctgatgaaatcagaggctccatcgta
aaggcatatgttgtcctgcaaaatcatgaaaaacgcagtgatgagcttgtcaaaatgctg
caaaaccatgtgaagacgattaccgctccatacaaatatcctagagaaattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system