KEGG   Bacillus subtilis subsp. subtilis RO-NN-1: I33_3509Help
Entry
I33_3509          CDS       T01837                                 

Gene name
tpiA
Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bsr  Bacillus subtilis subsp. subtilis RO-NN-1
Pathway
bsr00010  Glycolysis / Gluconeogenesis
bsr00051  Fructose and mannose metabolism
bsr00562  Inositol phosphate metabolism
bsr01100  Metabolic pathways
bsr01110  Biosynthesis of secondary metabolites
bsr01120  Microbial metabolism in diverse environments
bsr01130  Biosynthesis of antibiotics
bsr01200  Carbon metabolism
bsr01230  Biosynthesis of amino acids
Module
bsr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bsr_M00002  Glycolysis, core module involving three-carbon compounds
bsr_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bsr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    I33_3509 (tpiA)
   00051 Fructose and mannose metabolism
    I33_3509 (tpiA)
   00562 Inositol phosphate metabolism
    I33_3509 (tpiA)
Enzymes [BR:bsr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     I33_3509 (tpiA)
Exosome [BR:bsr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   I33_3509 (tpiA)
  Exosomal proteins of bladder cancer cells
   I33_3509 (tpiA)
  Exosomal proteins of melanoma cells
   I33_3509 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AEP92425
Position
complement(3276745..3277506)
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMNKTLGEAVSFVEEVKSSIPAADKAEAVVCAPALFLEKLTSAVKGTDLK
VGAQNMHFEESGAFTGEISPVALKDLGVDYCVIGHSERREMFAETDETVNKKAHAAFKHG
IVPIICVGETLEEREAGKTNDLVADQVKKGLAGLSEEQVAASVIAYEPIWAIGTGKSSTA
KDANDVCAHIRKTVAESFSQEAADKLRIQYGGSVKPANIKEYMAESDIDGALVGGASLEP
QSFVQLLEEGQYE
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccaattatcgccggtaactggaaaatgaacaaaacactcggcgaagctgtc
agcttcgttgaagaagtgaaatcttccattccagcagcagacaaagctgaagctgttgtt
tgcgcgccagcgcttttcttagaaaagcttacttctgctgtgaaaggcactgacctaaaa
gtcggcgctcaaaacatgcacttcgaagaaagcggcgcgttcacaggcgaaatcagcccg
gttgctctgaaagaccttggcgttgactactgtgtcatcggccactctgagcgccgtgaa
atgttcgctgaaactgatgaaacagttaacaaaaaagcacacgcagctttcaaacacggc
attgtgccgatcatctgtgtaggtgaaacgcttgaagagcgtgaagccggcaaaacaaat
gatcttgttgctgaccaagtgaaaaaaggccttgctggtctttctgaagaacaagttgct
gcttctgttattgcgtatgagccaatctgggcaatcggaacaggcaaatcttctacagcg
aaagatgcgaatgacgtgtgtgcgcatatccgtaaaaccgtcgctgaaagcttcagccaa
gaagctgcagacaagcttcgcatccaatatggcggaagcgtaaagcctgcaaacattaaa
gaatatatggcagagtccgatattgacggtgctttggtcggcggcgcgagccttgagcca
cagtcattcgttcaattattggaggaaggtcaatatgagtaa

DBGET integrated database retrieval system