KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_05240Help
Entry
BSUW23_05240      CDS       T01302                                 

Gene name
yhfS
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00071  Fatty acid degradation
bss00072  Synthesis and degradation of ketone bodies
bss00280  Valine, leucine and isoleucine degradation
bss00310  Lysine degradation
bss00362  Benzoate degradation
bss00380  Tryptophan metabolism
bss00620  Pyruvate metabolism
bss00630  Glyoxylate and dicarboxylate metabolism
bss00640  Propanoate metabolism
bss00650  Butanoate metabolism
bss00900  Terpenoid backbone biosynthesis
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
bss01212  Fatty acid metabolism
bss02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BSUW23_05240 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    BSUW23_05240 (yhfS)
   00640 Propanoate metabolism
    BSUW23_05240 (yhfS)
   00650 Butanoate metabolism
    BSUW23_05240 (yhfS)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BSUW23_05240 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    BSUW23_05240 (yhfS)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSUW23_05240 (yhfS)
   00310 Lysine degradation
    BSUW23_05240 (yhfS)
   00380 Tryptophan metabolism
    BSUW23_05240 (yhfS)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BSUW23_05240 (yhfS)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BSUW23_05240 (yhfS)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSUW23_05240 (yhfS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bss04147]
    BSUW23_05240 (yhfS)
Enzymes [BR:bss01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BSUW23_05240 (yhfS)
Exosome [BR:bss04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BSUW23_05240 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADM37101
UniProt: E0TYQ0
Position
complement(1070903..1071997)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVGAKRTIFGKQNGLLKPFLPEDLAAPIISCLSRNLEDQIDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGAGTMYIAGGSESSSRSPFSER
ARFSPDVIGDPDMGIAAEYTAANYSISRSMQDEYALLSYQRSRNAHDGGFYREEIVPLGE
LEMDEAFLKKRPIEAIISRAKPVFDTSSGTVTAANSSGISDGAAALLVLEEEKAASLGYK
PVLRFIGSAVSGIHPNYPPEAPVDAIRKLLSAHDVTPDDIDLYEINEAFAVKICVCSQEL
GIPFSKINVRGGALTLGHPYGASGAALVTRLFYEAQRRTDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgcggttattgttggtgcaaaacgaacgatttttggaaaacaaaacggactgcta
aagccatttctgccggaggatttagcggctcccatcatcagctgtctcagccgaaaccta
gaggatcaaatcgatgaagtgattctcggaaacgcgaccggcagaggcggcaacctcgcc
aggctgtcagctctgcaagccgggctgcctttatcggttcctgggatgacgattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagtctcattcaagccggagcc
ggtacgatgtatattgcgggcggctcagaaagcagcagtcgatcgcctttttcagaacgg
gcccgtttttctccagatgtaataggtgatcccgacatgggcatcgcagccgaatatacg
gcagcaaactattccatcagcagaagcatgcaggatgaatacgcgcttctcagctatcaa
cgcagcagaaacgcgcatgatggagggttttaccgtgaagaaattgttcccctcggagaa
ttggagatggacgaagcatttctgaaaaagcggccgatagaagcgattatttcccgtgca
aaaccggttttcgacaccagctccggaacggttacagcagccaacagcagcggcatatca
gacggagcggccgctctccttgtattggaagaagaaaaagcggcatctctcggctataag
ccagtgctccggtttatcggaagcgctgtcagcgggattcacccgaactatccgcccgag
gcaccggttgatgcgatccgtaagctcttatccgcacatgatgtcacacctgatgatatc
gatttatatgaaatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcatccccttctcaaaaatcaatgtgcgtggcggcgcattgactctaggccatccgtac
ggcgcatcgggtgcagctctggtaaccagattgttttatgaagcgcaaagacggacagac
tgtcaatatgccgttgcggctatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system