KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_11115Help
Entry
BSUW23_11115      CDS       T01302                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01130  Biosynthesis of antibiotics
bss01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    BSUW23_11115 (trpC)
Enzymes [BR:bss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     BSUW23_11115 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADM38263
UniProt: A3F3I6
Position
complement(2225981..2226733)
Genome map
AA seq 250 aa AA seqDB search
MLENIIKQKKEEVKTLVLPEEQPFEKRSFKEALASLNRFIGLIAEVKKASPSKGLIKENF
VPVRIAKDYETAKADALSVLTDTPFFQGENSYLSDVKRAVSIPVLRKDFIIDSLQVEESR
RIGADAILLIGEVLDPLHLHELYLEAGEKEMDVLVEVHDATTLEQILKVFTPDILGINNR
NLKTFETSIMQTEQIASLAPKESLLVSESGIGSLEHLTFVKEHGARAVLIGESLMRQTSQ
QKAIHALFGE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaaaacatcattaaacaaaagaaagaagaagtaaaaacactggtcttgccggaa
gagcagcctttcgaaaaacgttcatttaaagaggcgctggcaagcctgaatcggtttatc
gggttgattgctgaagtgaagaaagcgtcgccgtcaaaagggcttattaaagagaatttt
gtacctgtgcggattgcaaaagactatgaaactgcgaaagcagatgcgctttccgtttta
acagacaccccgttttttcaaggggaaaacagctatttatcagacgtaaagcgcgctgtt
tcgatacctgtactcagaaaagattttattattgattctcttcaagtggaggaatcaaga
agaatcggagcggatgccatattgttaatcggcgaagtgcttgatcccttacaccttcat
gaattatatcttgaagcaggtgaaaaggagatggacgtgttagtggaggttcatgatgca
acaacgctagaacaaatattgaaagtattcacgcctgatattctcggcataaacaaccga
aacctaaaaacttttgaaacctctatcatgcagacagaacaaatcgcatctcttgctccg
aaagaatcactgcttgtcagcgaaagcggaatcggttctttagaacatttaacatttgtc
aaagaacatggagcacgagctgtgcttattggtgaatcattgatgagacaaacatcacag
caaaaagcaatccatgctttgtttggggagtga

DBGET integrated database retrieval system