KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_11785Help
Entry
BSUW23_11785      CDS       T01302                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00030  Pentose phosphate pathway
bss00480  Glutathione metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
Module
bss_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bss_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSUW23_11785 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSUW23_11785 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bss04147]
    BSUW23_11785 (zwf)
Enzymes [BR:bss01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     BSUW23_11785 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     BSUW23_11785 (zwf)
Exosome [BR:bss04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   BSUW23_11785 (zwf)
  Exosomal proteins of colorectal cancer cells
   BSUW23_11785 (zwf)
  Exosomal proteins of bladder cancer cells
   BSUW23_11785 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ADM38395
UniProt: E0U2R0
Position
2335812..2337281
Genome map
AA seq 489 aa AA seqDB search
MKTNQQPKAVIVIFGATGDLAKRKLYPSIHRLYQNGQIGEEFAVVGVGRRPWSNEDLRQT
VKTSISSSADKHIDDFTSHFYYHPFDVTNPGSYQELNVLLNQLEDTYQIPNNRMFYLAMA
PEFFGTIAKTLKSEGVTATTGWSRLVIEKPFGHDLPSAQALNKEIREAFTEDQIYRIDHY
LGKQMVQNIEVIRFANAIFEPLWTNRYISNIQITSSESLGVEDRARYYEKSGALRDMVQN
HIMQMVALLAMEPPIKLNTEEIRSEKVKVLRALRPIAKDEVDEYFVRGQYQAGEIDGVPV
PAYTDEDNVAPDSNTETFVAGKLLIDNFRWAGVPFYIRTGKRMKEKSTKIVVQFKDIPMN
LYYGNENNMNPNLLVIHIQPDEGITLYLNAKKLGGAAHAQPIKLDYCSNCNDELNTPEAY
EKLIHDCLLGDATNFAHWDEVALSWNFVDSISETWAANKILSPNYESGSMGPKESDDLLA
KDGLHWWNI
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaacaaaccaacaaccaaaagcagtaattgttatattcggtgcaactggagattta
gcaaaacgaaaactgtatccgtctattcaccgtttatatcaaaacggacaaatcggagaa
gagtttgcagttgtaggagttggaagaagaccatggtccaatgaggaccttcgccaaacc
gttaaaacatccatttcctcatctgcagataaacatatagatgatttcacgtctcatttt
tactatcacccgtttgacgtgacaaaccctggctcttatcaagagcttaacgtattgctt
aaccagttggaagatacatatcaaattccgaacaacagaatgttctacctagcaatggct
cctgaattcttcgggacaattgcaaaaacattaaaatcagaaggtgttacagcaacaaca
ggctggtcccgccttgtcattgaaaagccgttcggccatgatctgccaagcgcacaggca
ctaaacaaagaaatccgcgaagcatttacggaagatcaaatttacagaatcgaccattat
ctaggcaaacaaatggttcagaacattgaagtgattcgatttgccaatgcgattttcgaa
ccgctttggacaaaccgctacatctcaaacattcaaatcacatctagcgaatcacttggc
gtcgaagaccgtgcaagatattacgaaaaatcaggcgccctgcgcgacatggtacaaaac
cacattatgcagatggttgcccttcttgcaatggagccgccgatcaaattgaacacagaa
gaaatcagaagcgaaaaagtaaaggttctgagagcactgcgccctattgcaaaagacgaa
gtggatgagtactttgtgcgcggacaatatcaagccggtgaaattgacggtgtgccggtt
cctgcttatacggatgaagataatgtcgctcctgactcaaatacagaaacctttgttgca
ggcaagctcttgatcgacaacttcagatgggccggtgttccattctatatccgcaccgga
aaacgaatgaaagaaaagtccacaaaaatcgtcgttcaatttaaggacattccaatgaac
ctgtactacggcaatgaaaacaacatgaatccaaacttgcttgtcatccatattcagcct
gacgaaggcattacgctatacttaaacgctaaaaagcttggcggagcagcacatgcacag
cctatcaaactcgattactgcagcaattgcaatgacgagttgaacacccctgaagcgtat
gaaaaattaattcatgactgtcttcttggagatgcaacaaactttgcacactgggatgaa
gttgccctttcttggaactttgttgattccatttctgaaacatgggcagcaaacaaaatc
ttgtctcctaactacgagtcaggctctatgggaccgaaagaatcagatgatcttttggcg
aaagacggcttgcactggtggaatatataa

DBGET integrated database retrieval system