KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_14320Help
Entry
BSUW23_14320      CDS       T01302                                 

Gene name
ytjI
Definition
(GenBank) putative acyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00010  Glycolysis / Gluconeogenesis
bss00620  Pyruvate metabolism
bss00640  Propanoate metabolism
bss00680  Methane metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_14320 (ytjI)
   00620 Pyruvate metabolism
    BSUW23_14320 (ytjI)
   00640 Propanoate metabolism
    BSUW23_14320 (ytjI)
  Energy metabolism
   00680 Methane metabolism
    BSUW23_14320 (ytjI)
Enzymes [BR:bss01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BSUW23_14320 (ytjI)
Lipid biosynthesis proteins [BR:bss01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BSUW23_14320 (ytjI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ADM38901
UniProt: E0TWP4
Position
complement(2808186..2809775)
Genome map
AA seq 529 aa AA seqDB search
MLKREDLIAPMQYNLVNEMEKFSAAGQKTALLWEDESGKQKSWSYEKLMEETNKIGAALA
DLGFKKGDKLIVMVPRVLEAYAVYLAILKSGMVVIPCSEMLRAKDLEYRIEHAEVKGAIV
YSEFIGAFRDVSTADKLIKLSIGENDAGWKNLLSIQADGSRFQTADTTREDMAFLSYTSG
TTGQPKGVVHTHGWAFAHLKTSAGAWLDISEKDIVWATAAPGWQKWVWSPFLAVLGSGAT
GFVYHGRFKAEKYLELLNRYKINVFCCTPTEYRLMAKVEGLDRYDLSALHSAVSAGEPLN
REVIDVFQKHFGIKVRDGYGQTESTLLVGVLKDMDIKPGSMGKPTPGNQVEIINEDGEIC
KSGEVGDIAVHLSTPALFKEYYKDPERMKTQIRGDYFLTGDRAKKDEEGYFWFESRNDDI
IISSGYTIGPFEVEDALVKHPEVKECAVVASPDEIRGSIVKAYVVLQNHEKRSDELVKIL
QNHVKTITAPYKYPREIEFVESLPKTASAKIRRVELRKREEQLKANKKA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaaaacgagaagatttaattgcccctatgcaatataatttagtgaatgaaatggaa
aagttcagtgccgctggacaaaaaaccgctcttctatgggaggatgagtcgggtaagcaa
aaatcttggtcatatgaaaagctgatggaagaaacaaataaaattggagcagctttggct
gaccttggatttaaaaagggagacaagctgattgtaatggttccgcgggtgcttgaagcc
tatgctgtttatttggctatcctaaaatcaggaatggttgtcattccgtgctcggaaatg
cttcgtgcgaaagatcttgaatatcggattgaacatgcagaagtaaaaggcgccatcgtc
tattctgaatttatcggcgctttccgtgatgtcagtacggctgacaaactgattaaactg
tctattggcgaaaacgatgccggctggaaaaatctcttatcgatccaagcggacggaagc
cgattccaaacagctgacacaacaagagaagatatggctttcttatcttatacatccgga
acaacaggtcagcctaaaggtgttgtacatacacacggatgggcatttgctcatttaaaa
acatctgccggcgcttggcttgatatttctgaaaaagatatcgtctgggcgactgctgcc
cctggctggcaaaagtgggtgtggagcccgtttttagcggtactcggaagcggagcaacg
ggttttgtgtaccacggcagattcaaagcagaaaaatatttagaacttttaaaccgctac
aaaatcaatgtcttttgctgtacgccaacggaataccgcttaatggcgaaggtcgaaggt
ttagaccgatatgatctttctgccctgcacagcgcagtgtccgcaggcgagccgctcaac
cgtgaagtcattgatgtgttccaaaagcacttcggcattaaggtgcgggacgggtatggc
caaacggaaagcacgcttttagtcggtgtcttgaaagatatggatattaaaccgggaagc
atgggaaaaccgacaccgggaaatcaggtggagatcattaatgaagacggtgaaatctgc
aaatctggtgaggttggcgatatcgcagttcaccttagcacgccggcactctttaaagaa
tattacaaagatcctgaaagaatgaaaacacaaattcgcggcgattatttcctaacagga
gacagagcaaaaaaagatgaggaaggttacttctggtttgaaagccgaaatgacgatatc
attatcagctccggctacaccatcgggccattcgaagtggaagacgcgcttgttaagcac
cctgaagtaaaagaatgtgctgttgtcgcaagccctgatgaaatcagaggatccatcgtt
aaggcgtacgttgtcctgcaaaatcacgaaaaacgcagtgatgagcttgtcaaaatactg
caaaaccatgtgaagaccattaccgctccatacaaatatccgagagagattgaatttgtg
gaaagcctgccgaaaacggcttctgcaaaaatcagacgagtggaattaagaaaacgtgaa
gaacagctcaaagccaataaaaaggcgtaa

DBGET integrated database retrieval system