KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_18335Help
Entry
BSUW23_18335      CDS       T01302                                 

Gene name
fbaA
Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K01624  fructose-bisphosphate aldolase, class II [EC:4.1.2.13]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00010  Glycolysis / Gluconeogenesis
bss00030  Pentose phosphate pathway
bss00051  Fructose and mannose metabolism
bss00680  Methane metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01120  Microbial metabolism in diverse environments
bss01130  Biosynthesis of antibiotics
bss01200  Carbon metabolism
bss01230  Biosynthesis of amino acids
Module
bss_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bss_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
bss_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BSUW23_18335 (fbaA)
   00030 Pentose phosphate pathway
    BSUW23_18335 (fbaA)
   00051 Fructose and mannose metabolism
    BSUW23_18335 (fbaA)
  09102 Energy metabolism
   00680 Methane metabolism
    BSUW23_18335 (fbaA)
Enzymes [BR:bss01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     BSUW23_18335 (fbaA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase 4HFCP_synth
Motif
Other DBs
NCBI-ProteinID: ADM39702
UniProt: E0TVC0
Position
complement(3618188..3619045)
Genome map
AA seq 285 aa AA seqDB search
MPLVSMTEMLNTAKEKGYAVGQFNLNNLEFTQAILQAAEEEKSPVILGVSEGAGRYMGGF
KTVVAMVKALMEEYKVTVPVAIHLDHGSSFESCAKAIHAGFTSVMIDASHHPFEENVATT
SKVVELAHFHGVSVEAELGTVGGQEDDVIAEGVIYADPKECQELVERTGIDCLAPALGSV
HGPYKGEPNLGFKEMEEIGNTTGLPLVLHGGTGIPTADIKKSISLGTAKINVNTENQISS
AKAVRETLAAKPDEYDPRKYLGPAREAIKETVIGKMREFGSSNQA
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagtttctatgacggaaatgttgaatacagctaaagaaaaaggttatgctgta
ggacaatttaacttaaacaaccttgagtttactcaagccattttacaagcagctgaagaa
gaaaaatctccagtgatccttggtgtttccgaaggtgcgggacgctacatgggcggcttc
aaaacagtcgttgctatggtaaaagcacttatggaagagtacaaagtgacagttcctgtt
gcgattcacttagaccacggttcaagctttgaatcttgtgcgaaagcgattcatgcaggt
ttcacatctgtaatgatcgacgcttctcaccatccatttgaagaaaacgtagcaacaact
tctaaagttgttgagcttgctcatttccacggagtatctgtagaagctgagcttggaaca
gtcggcggacaagaagatgacgttattgctgaaggcgtaatctacgctgaccctaaagag
tgccaagagcttgttgagcgcacgggcatcgactgccttgcacctgcattaggttctgtt
cacggcccttacaaaggtgagccaaaccttggcttcaaagagatggaagagatcggaaac
acaactggtcttccgctagttcttcacggcggtactggaattccgactgctgacatcaaa
aaatcaatttcacttggtacagctaaaatcaacgtgaatactgaaaaccaaatttcttct
gcaaaagctgttcgcgaaacattggcagctaagcctgacgagtacgatccacgtaaatat
cttggaccagctcgtgaagcgatcaaagaaacagttatcggtaaaatgcgtgaatttggt
tcttcaaaccaagcttaa

DBGET integrated database retrieval system