KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_19100Help
Entry
BSUW23_19100      CDS       T01302                                 

Gene name
dltC
Definition
(GenBank) D-alanyl carrier protein
  KO
K14188  D-alanine--poly(phosphoribitol) ligase subunit 2 [EC:6.1.1.13]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00473  D-Alanine metabolism
bss01100  Metabolic pathways
bss01503  Cationic antimicrobial peptide (CAMP) resistance
bss02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bss00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    BSUW23_19100 (dltC)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSUW23_19100 (dltC)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    BSUW23_19100 (dltC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:bss01504]
    BSUW23_19100 (dltC)
Enzymes [BR:bss01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.13  D-alanine---poly(phosphoribitol) ligase
     BSUW23_19100 (dltC)
Antimicrobial resistance genes [BR:bss01504]
 Gene sets
  CAMP resistance modules
   Cationic antimicrobial peptide (CAMP) resistance, dltABCD operon [MD:M00725]
    BSUW23_19100 (dltC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PP-binding
Motif
Other DBs
NCBI-ProteinID: ADM39854
UniProt: E0TWR8
Structure
PDB: 

Position
3764983..3765219
Genome map
AA seq 78 aa AA seqDB search
MEFKQEVLDVLAEVCQDDIVKENPDIEIFEEGLLDSFGTVELLLAIENRFDILVPITEFD
RDVWNTPNNIVNQLSELK
NT seq 237 nt NT seq  +upstreamnt  +downstreamnt
atggaatttaaacaagaggtattagacgttttagcagaggtttgccaggatgacatcgta
aaggaaaatcctgatattgaaatttttgaagaaggtttgcttgattcttttggaacagta
gaattgctgcttgcgattgaaaaccgttttgatattttagtgccgatcactgagtttgat
cgggatgtttggaatacgcctaacaacattgtaaatcagctgtctgagttgaaataa

DBGET integrated database retrieval system