KEGG   Bacillus subtilis subsp. spizizenii W23: BSUW23_20115Help
Entry
BSUW23_20115      CDS       T01302                                 

Gene name
argI
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
bss  Bacillus subtilis subsp. spizizenii W23
Pathway
bss00220  Arginine biosynthesis
bss00330  Arginine and proline metabolism
bss01100  Metabolic pathways
bss01110  Biosynthesis of secondary metabolites
bss01130  Biosynthesis of antibiotics
bss01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bss00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    BSUW23_20115 (argI)
   00330 Arginine and proline metabolism
    BSUW23_20115 (argI)
Enzymes [BR:bss01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     BSUW23_20115 (argI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase SHOCT
Motif
Other DBs
NCBI-ProteinID: ADM40055
UniProt: E0TZA6
Position
complement(3964263..3965153)
Genome map
AA seq 296 aa AA seqDB search
MDKTISVIGMPMDLGQARRGVDMGPSAIRYAHLIERLSDMGYTVEDLGDIPISREKIKND
EELKNLNSVLAGNEKLAQKVNTVIEEKKFPLVLGGDHSIAIGTLAGTAKHYDNLGVIWYD
AHGDLNTLETSPSGNIHGMPLAVSLGIGHESLVNLEGYAPKIKPENVVIIGARSLDEGER
QYIKESGMKVYTMHEIDRLGMTKVIEETLDYLSACDGVHLSLDLDGLDPNDAPGVGTPVV
GGISYRESHLAMEMLYDAGIITSAEFVEVNPILDHENKTGQTAVELVESLLGKKLL
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atggataaaacgatttcggttattggaatgccaatggatttaggacaagcacgacgcgga
gtggacatgggaccaagtgccatccggtatgcccatctaattgagaggctgtcagacatg
ggttatacggttgaagatctcggtgacattccgatcagccgtgaaaagatcaaaaacgat
gaagaactgaaaaacctaaattccgtactggcaggaaacgaaaagctcgctcaaaaggtg
aacaccgtaattgaagagaaaaaattcccacttgtcctgggcggcgaccacagtattgcg
atcggcacgctggcaggcacagcgaagcattacgataatctcggcgtcatctggtatgac
gcgcacggcgacctgaatacacttgaaacatcaccttcaggcaatattcacggcatgccg
cttgccgtcagcctcggcatcggccatgagtcactggttaaccttgaaggctacgcccct
aaaatcaaaccggaaaacgtcgtcattatcggcgctcggtcacttgatgaaggagagcgc
caatatattaaggaaagcggcatgaaggtgtacacgatgcacgaaatcgaccgtctcggc
atgaccaaggtgatcgaagaaacccttgattatttatcagcatgtgacggcgtccatctc
agccttgatctggacggacttgatccaaacgacgcaccgggtgtcggaacccctgtcgtc
ggcggcatcagctaccgggagagccacctggctatggaaatgctgtatgacgcaggcatc
atcacctcagctgaattcgttgaggtcaacccgattcttgatcacgaaaacaagactggc
caaacagcagtagagctcgtagaatctctgctagggaaaaagttgctgtaa

DBGET integrated database retrieval system