KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0026Help
Entry
GYO_0026          CDS       T01635                                 

Gene name
recR
Definition
(GenBank) recombination protein RecR
  KO
K06187  recombination protein RecR
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bst00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    GYO_0026 (recR)
DNA repair and recombination proteins [BR:bst03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     GYO_0026 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      GYO_0026 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_5 HHH_8 Zn_ribbon_17 PI3_PI4_kinase
Motif
Other DBs
NCBI-ProteinID: AEP84796
UniProt: G4NT17
Position
28940..29536
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDVVLDFAKALVNAKRNLTYCSVC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagatgtggta
ttagattttgcgaaagcattagtaaatgcgaaacgcaacctgacatattgttcagtttgc
gggcatattacagatcaggacccttgctatatatgtgaagatacacgcagggataagtcc
gttatctgtgttgtgcaagaccctaaggatgttatcgctatggagaaaatgaaggaatac
aacggacagtatcacgttcttcacggcgccatttctccaatggacggcatcggaccagag
gatattaaaataccagaattgttaaaacgattacaggatgatcaagtgacagaagtgatt
ctcgcaactaaccctaatatagaaggggaagcaacggcgatgtatatatcaaggctcctg
aagccgtctggtattaagctctcccgtattgcccacggactgcccgtcggcggcgatttg
gaatatgctgatgaggtcactctttctaaagcacttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system