KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0400Help
Entry
GYO_0400          CDS       T01635                                 

Definition
(GenBank) cytochrome P450
  KO
K15629  fatty-acid peroxygenase [EC:1.11.2.4]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:bst00199]
    GYO_0400
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.2  Peroxygenases
    1.11.2.4  fatty-acid peroxygenase
     GYO_0400
Cytochrome P450 [BR:bst00199]
 Cytochrome P450, bacteria type
  CYP152 family
   GYO_0400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-ProteinID: AEP85119
UniProt: G4NQN4
Position
338038..339291
Genome map
AA seq 417 aa AA seqDB search
MNEQIPHDKSLDNSLTLMQEGYLFIKNRTERYHSDLFQARLLGKTFICMTGAEAAKLFYD
TERFQRQNALPKRVQKTLFGVNAIQTMDGDAHIHRKLLFLSLMTPPHQKRLAELMTEEWE
AAVTRWEKADQVVLFEEAKEILCRVACYWAGVPLKETEVKERADDFIDMVDAFGAVGPRH
WKGRRARPRAEEWIERMIEDVRAGLLKIPAGTALHEMAFHTQEDGNQLDSRMAAIELINV
LRPIVAISYFLVFSALALHKHPKYKEWLRSGSNREREMFVQEVRRYYPFGPFLGALVKKD
FEWNTCEFKKGTSVLLDVYGTNHDPRLWDNPDEFRPERFEEREENPFDLIPQGGGHAEKG
HRCPGEGITIEVMKASLDFLVNQIEYDVPEQSLHYSLARMPSLPESGFVMSGIRRKS
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgaatgagcagattccacatgacaaaagtcttgataacagcctgacgctgatgcaggaa
ggatatttgtttattaaaaacagaacagagcgctatcactcagacctgtttcaggctcgt
ttattgggaaaaacctttatttgcatgaccggtgctgaggcagcgaagctgttttatgat
acggagcggtttcagcggcagaatgctttgccgaagcgggtgcagaaaacgctgtttggc
gtaaatgcgattcagacgatggatggcgacgcgcatatccatcggaagctgctttttctg
tcattaatgacaccgccgcatcaaaagcgtttggctgagctgatgacagaggagtgggaa
gcggcagtcacgagatgggagaaggcggatcaggttgtgttatttgaggaagcaaaagaa
atcctatgcagggtggcgtgctattgggctggcgttccgctgaaggaaacggaagtcaaa
gagagagcggatgacttcattgatatggtcgacgcgttcggtgctgtggggccgcggcat
tggaagggaagaagagcaaggccgcgtgcggaagagtggattgaaagaatgattgaagat
gttcgtgccggcttgctgaaaatacctgccggaacagcactgcatgaaatggcgtttcac
acacaagaagatggcaaccagctggattcccggatggccgccattgagctgattaatgtc
ctgcggcctatcgtcgccatttcttactttcttgtgttttcagctttggcgcttcataag
catccgaagtataaggaatggctgcgttctggaagcaaccgggaaagagaaatgtttgtg
caggaggttcgcagatattatccgttcggcccgtttttaggggcgcttgttaaaaaggat
tttgaatggaatacctgtgagtttaagaagggcacgtcggtactgcttgatgtttatgga
acgaatcacgaccctcgcttatgggacaaccctgatgaatttcggcctgaacgatttgag
gagcgggaggaaaatccgtttgatttgattcctcaaggcggaggtcacgcggagaaaggg
catcgctgtccaggggaaggcattactattgaagtcatgaaagcaagcctggattttctc
gtcaatcagattgaatacgacgttccggaacaatcgctgcattacagtctcgcgagaatg
ccgtcattgcctgaaagcggttttgtgatgagcggaatcagacggaaaagttaa

DBGET integrated database retrieval system