KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0649Help
Entry
GYO_0649          CDS       T01635                                 

Definition
(GenBank) hypothetical protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: BcsB DUF4448 TMEM154 DUF5383 BPA_C Orf78 TRAP_beta
Motif
Other DBs
NCBI-ProteinID: AEP85356
UniProt: G4NTZ6
Position
599466..601577
Genome map
AA seq 703 aa AA seqDB search
MKQIMIFLTSFMLMAMAGQTAFAKEVEVSGSLLGKSSQEQAKQQVLTSDLITLYGSKDSA
ELTYQIPAGASSGNQQLVIEYEASNLLISPSSLTAVIDDEPVKTLKLDGDYKRKTVKLNL
NKSQSAQGYHNVSLKFYGVMKEGVCVRQDTSGNWIKIYPDSRLTLADSSEAKGTSLDHYP
YPFAQSGNTAEETAIVIPDDPSSAEIEAAAKTEGYLKTADSSVSISYVTESELKKIDKPT
IFIGVDKHWNGKVKKLMKQAGLQAKGDKLLLAERVLKAEGKQQPVLFAEASSDDVLTEKI
SVITDQTYTGQLSGDTLSISKLKQAEKKESNKLTLENFGAGDITIGADKTSSAHYFYPAS
AVLDQNQSAKLSLKLKKSETIQALTAENESVSQAAELKIMINGQPHSVRLDDLGKEDKNG
FYHVMVKVDPKLLQKNRYIDIQFVTTGLKENNPCNTTDEEKWVFIDKSSTLSYAIKDMSP
SADFQEWPLPYAGNQEQTTLIVLPDTVSQSKLAELSLVTESFGSEAQHTYTVKKSSDVTA
NDAKGRNLIFIGGIDQFSLLKEKSSDLLVPQTKNGSFDVSGFEMLNETTKRVAFTQASLW
DTRYTMAVFAPSKGTGTAVTKEIISYLNSTDDSATVVNETTSQQVFTNHQQLKSETNSSS
AEQSSQDNSQKWLYIGVLALIMVIAAVFIWVAVRRRKRKTDTE
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacaaataatgatttttctcacaagcttcatgctcatggcgatggccggacaaacg
gcttttgccaaagaggtggaggtcagcggttcgctcctcggaaaaagcagccaagaacaa
gccaaacagcaggtgctgacaagcgacctgattacactgtacggatcaaaagacagcgcg
gagctgacgtatcagatcccggcaggcgcatcttccggcaaccagcaattggtgattgaa
tacgaggcatcaaatcttttaatttctccatcatcgttaacggctgtcattgacgatgaa
ccggtcaaaacgttaaagcttgatggtgattacaaacggaaaacagtaaagctaaacctg
aataaaagccagtctgcccaaggctatcacaacgtatcgctgaaattttacggcgtgatg
aaagagggcgtttgcgtcagacaggatacgtccggcaactggatcaaaatttatccggac
agccgcctgacgctggcggacagcagtgaagcgaagggaacgtcgctggatcattatcca
tatcctttcgcccaatcgggaaatacagcggaagaaaccgccatcgtcattccggatgac
ccaagttcggccgaaatcgaagctgcagctaaaacagaaggctatttgaaaacggcggac
agcagtgtcagcatttcgtatgttacggaatctgaactgaagaaaatagacaagccgacg
attttcatcggcgtggacaagcattggaacggcaaggtgaaaaagctgatgaaacaagcc
ggcttacaggcaaaaggagacaagctcctgcttgcggagcgggtgctgaaagcagagggc
aagcagcagccggttctgtttgcggaagcgtcatccgatgatgtgctcactgaaaaaatc
agtgtcatcacggatcagacttatacaggccagctcagcggcgacacactctcaatcagc
aagctgaagcaggcagaaaaaaaagaaagcaataagctgactctcgagaattttggagcg
ggtgatatcacaattggagctgacaaaacttcttctgcacattacttttatccagcttcg
gcggttttagaccaaaaccaatcagcaaagctgtcgctcaagctgaagaagtccgaaaca
attcaagccttaacggcggaaaacgaatcggtttctcaggcggcagaactgaagatcatg
atcaatggccagccgcactcggtccggcttgatgatttaggaaaagaagataaaaacgga
ttctatcatgtcatggtaaaagtggaccctaaactgctgcaaaaaaaccgctacattgat
attcagttcgttacgactgggctaaaggaaaacaatccttgcaacaccactgatgaagaa
aagtgggtctttatcgataaaagcagtacattgtcttacgccatcaaagatatgtctccg
tcagcggatttccaagagtggccgcttccttacgctggaaatcaggaacaaacaacgcta
atcgttcttcctgacaccgtaagccaatcgaagcttgcggaactttctctcgtaacggag
tccttcggcagtgaagcgcagcacacatatacggtgaaaaaatcatctgatgtaacagca
aatgatgccaaagggcggaacctcattttcatagggggtatcgatcaattttctcttctg
aaggagaaatcatcagatctgcttgttccgcaaacaaagaacggctcgtttgatgtatca
ggttttgagatgctgaatgagacaacaaaacgagtggcatttactcaagcgtctctttgg
gatacacgctacacaatggctgtctttgcaccatcaaaaggaactggcacggctgtcacg
aaagagatcatcagttatctgaatagtaccgatgactcggcaaccgtcgttaacgaaacc
accagccagcaggtgtttacaaaccaccagcagcttaaatctgaaactaacagttccagc
gcagagcaatcatcacaggataatagccagaaatggctgtatattggcgtgctggcactt
attatggtgattgcggcagtgttcatttgggttgccgtaagacgaagaaaaagaaagaca
gatacagaataa

DBGET integrated database retrieval system