KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0650Help
Entry
GYO_0650          CDS       T01635                                 

Definition
(GenBank) hypothetical protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 60KD_IMP
Motif
Other DBs
NCBI-ProteinID: AEP85357
UniProt: G4NTZ7
Position
602050..603873
Genome map
AA seq 607 aa AA seqDB search
MYHSIKRFLIGKPLKSQAAGEQKLTKLKALAMLSSDALSSVAYGTEQILIILATISAAAF
WYSIPIAIGVLILLLALILSYRQIIYAYPQGGGAYVVSKENLGEKPGLIAGGSLLVDYIL
TVAVSISAGTDAITSAFPVLHDYHVPIAVLLVLVIMILNLRGLSESASILAYPVYLFVVA
LLVLIAVGLFKLMTGQIDQPVHHTPLGTPVAGITLFLLLKAFSSGCSALTGVEAISNAIP
AFKNPPARNAARTLAMMGILLAILFSGITVLAYGYGTAPKPDETVVSQIASETFGRNVFY
YVIQGVTSLILVLAANTGFSAFPQLAFNLARDQYMPRMFTVRGDRLGFSNGIIFLGVASI
VLILLFGGQTEHLIPLYAVGVFIPFTLSQTGMCIKWIKQKPKGWIGKMLINSCGALISFM
VLSVLFVTKFNVVWPVLIFMPIVVLLFFAIKNHYTAVGEQLRIVDKEPEEIKGTVVIVPV
AGVTTVVQKSIHYAKSLSDQVIAVHVSFDREQEKKFEKRWEELNNGVRLVTLHSSYRSLV
HPFDKFLETVEAKAKKEQFSVMVLFPQFITKKRWHTILHNQSAFLLRVRLFWKKDIMVAT
LPYHFKK
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtatcattcaatcaaacgttttttgattgggaaaccactaaaatctcaagcagctgga
gagcaaaaactgacgaaattaaaagccttagcgatgctttcctcagatgcgctttcatct
gtcgcatacggcacagaacaaattttaatcattttggcaacaatcagtgctgctgcattt
tggtactccattccgattgcgattggcgtcctcatattgctgctcgcactgattctttca
tacaggcaaattatttacgcttacccgcagggcggcggagcgtatgttgtgtcgaaagaa
aacctcggtgaaaagccgggattgatcgcaggcggttcactgcttgtcgattatatttta
acggtagcggtaagtatttccgcaggaacggacgctatcacgtcggcctttcctgtattg
catgattatcatgtgccgattgctgttttacttgttttagtcattatgattttgaacctg
cgcgggctttcggaatcagcatcgattcttgcctatccggtttatctgtttgtggtggca
cttttggttttgatagcagtcgggttgtttaaactcatgacagggcaaatagaccagcca
gtccatcatacaccgctcggtacacctgtagccggcattacgctgtttttgctgctcaag
gctttttcttcgggctgctcggctttgaccggggttgaggccatttctaacgcgattcct
gctttcaaaaacccgcctgcgcgaaacgcggctagaactcttgcaatgatgggcattttg
ctggcgattctgttttctgggatcacggtgctcgcatacggctatggaacggcgccgaag
cccgatgaaacggtggtttcacaaattgcgtctgaaaccttcgggcggaatgtgttctac
tatgtgatccaaggtgtcacatcacttattttggtccttgcggcaaatacgggattttca
gccttcccgcagcttgccttcaacctggcgagagaccagtacatgccgcgtatgtttaca
gtcagaggcgaccgcttaggcttctcaaatgggattatctttttaggcgttgcttcgatt
gtgctcatcctgctattcggaggacagacagagcatttaatcccgttatatgctgtgggc
gtatttattccatttacgctttcgcaaaccggcatgtgcatcaaatggattaagcaaaaa
ccaaaagggtggatcggaaaaatgctgatcaactcctgcggcgctttgatttcgtttatg
gttctgtcggtcctgtttgtgacgaagtttaatgttgtatggcctgtgttaatctttatg
cctatcgtcgttttactgttttttgcgattaaaaatcactacacagctgtcggtgaacag
cttcgcatcgtagacaaagagccagaagaaatcaaaggcacggttgtgattgtgcctgta
gctggtgtcaccaccgtcgtgcaaaaatcgattcactatgcgaaatcactgtccgatcag
gtgatcgcagttcacgtgtcatttgacagagaacaggaaaagaaattcgaaaaacgctgg
gaagagctcaataacggagtgcgtctcgttacgcttcactcctcgtacagaagccttgtc
catccgtttgataagtttttggaaacagttgaggcaaaagcgaagaaggagcagttttcc
gtcatggtgctgtttccgcaatttattacgaaaaaacgctggcacaccatccttcacaac
caatcggctttcctcctcagagtccggctgttctggaaaaaggacataatggttgccacg
ctgccgtatcattttaaaaagtaa

DBGET integrated database retrieval system