KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0662Help
Entry
GYO_0662          CDS       T01635                                 

Definition
(GenBank) manganese catalase
  KO
K07217  Mn-containing catalase
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    GYO_0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mn_catalase Ferritin Rubrerythrin
Motif
Other DBs
NCBI-ProteinID: AEP85369
UniProt: G4NU09
Position
complement(611440..612261)
Genome map
AA seq 273 aa AA seqDB search
MFKHTKKLQHPAKPDRPDPLFAKKMQEILGGQFGEISVAMQYLFQGWNTRGNEKYKDLLM
DTATEELGHVEMIATMIARLLEDAPLDQQEKAAEDPVIGSILGGMNPHHAIVSGLGAMPE
SSTGVPWSGGYIVASGNLLADFRANLNAESQGRLQVARLFEMTDDKGVKDMLSFLLARDT
MHQNQWLAAIKELEAQEGPIVPGTFPKALEKQEFSHQLINFSEGEESAEQTWLNEKAPDG
EAFEYVKEAKAFGEKPELKPAPPFVHDTLPGRE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagcatacgaaaaagctgcagcatcctgctaaaccagatcgtccagatccatta
ttcgctaaaaaaatgcaagaaattttaggcgggcaattcggagaaatttctgttgccatg
caatacttatttcaaggctggaatacaagaggaaatgaaaaatacaaggatttgctgatg
gatacggcaactgaggaactcgggcatgttgaaatgatcgctacgatgattgcgagactt
cttgaggatgccccgcttgatcagcaggaaaaagccgctgaagatccggtcatcggctcc
atcctgggcggcatgaaccctcaccatgcaattgtatcaggacttggcgccatgccggaa
agcagtacaggcgtaccttggagcggcggctatatcgtagcaagcggaaacctgctggca
gacttccgcgccaatctgaatgcggaatcacaaggccgtctgcaggttgcacgcctgttt
gaaatgacggatgacaaaggcgttaaagatatgctcagcttcctgctggcgcgtgacacg
atgcaccaaaaccaatggctcgccgctattaaagaattagaagcacaagaaggcccgatt
gtgccggggaccttcccgaaagcacttgaaaaacaagagttctcgcatcagcttatcaat
ttctctgaaggcgaggaaagcgccgaacaaacctggctgaacgaaaaagcgccggatgga
gaagcctttgaatatgtgaaagaagctaaagcttttggagaaaaaccggaattaaaacca
gcaccgccttttgttcatgatacgcttccgggacgcgagtaa

DBGET integrated database retrieval system