KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0664Help
Entry
GYO_0664          CDS       T01635                                 

Gene name
dctS
Definition
(GenBank) C4-dicarboxylate histidine kinase DctS
  KO
K11691  two-component system, CitB family, sensor histidine kinase DctS [EC:2.7.13.3]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst02020  Two-component system
Module
bst_M00489  DctS-DctR (C4-dicarboxylate transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:bst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GYO_0664 (dctS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bst01001]
    GYO_0664 (dctS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bst02022]
    GYO_0664 (dctS)
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     GYO_0664 (dctS)
Protein kinases [BR:bst01001]
 Histidine kinases
  CitB family [OT]
   GYO_0664 (dctS)
Two-component system [BR:bst02022]
 CitB family
  DctS-DctR [MD:M00489]
   GYO_0664 (dctS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: sCache_3_2 HATPase_c HATPase_c_5 SPOB_a sCache_2 PAS_8 PAS_10 HATPase_c_2 PAS_9 dCache_2 PAS CsgF dCache_3 SpoVT_C Ly49 PAS_7
Motif
Other DBs
NCBI-ProteinID: AEP85371
UniProt: G4NU11
Position
613469..615076
Genome map
AA seq 535 aa AA seqDB search
MNKKKLSIRWKITILSYILVIFSFLIGGIVLIGNIQHTEERELKKRLMNTARTVSEMTEV
KEALARNKQTEAVRHAVEEIRMINEADYIVVMDMNHIRYTHPVSTSIGKKSEGADEEAAF
AEHIYFSEAKGEIGTAVRAFYPVKDHDLNQIGVVLVGKTLPGIADILLHLKRDITFIVVL
TLGFGLAGSFLLARHIKKQMFQLEPHEIVRMYEERTATFHSMNEGVIAIDNRLIITIFNE
KAKQIFEVQGNLVGKVIWDVLKDSRLPEIVERNKAVYNEEIRVSGKVIMSSRIPIVMKKK
VIGAVAIFQDRTEAAKMAEELTGVKNFVEALRVQNHEHMNKLHTIAGLIQLGKSEKALQL
AFQASTEQENVTEFLHRSIQNDAAAGLLLSKIRRGRELGIAVHIDENSSLQQFPEHVDQH
DIVVLLGNLIENAFGSFETVQSDDKRIDISIEQTDDILAILIEDNGCGIEPTHMPHLYDK
GFTVNKTGGTGYGLYLVKQITDKGSGTIEVDSHAGQGTSFSIVFPMKGEEAQHDS
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaagaagctctcaatccgttggaaaatcacgatcttatcctatatactcgtc
attttctcctttttgatcggcggcattgtgctcattggcaatatccagcatacagaggag
cgggagctgaaaaaacgtttgatgaatacggcccggacggtgtcagagatgacagaagtg
aaagaggccttggcgagaaacaaacaaacagaagcggttcgccatgcggttgaagaaatc
aggatgattaatgaagcagactatattgtcgtcatggatatgaatcacatccgatatacg
catcctgtcagcacaagcatcggcaagaaatctgagggtgcagacgaggaggcggcgttt
gcggagcacatttatttctcagaagcaaagggtgagatcggcacggcggtccgggctttt
tatccggtgaaggatcatgatctgaaccagattggcgtggtgcttgtcgggaaaacactg
ccggggatcgcagacatcctgcttcatttaaagcgagatattacattcatcgttgtgctg
acactaggcttcggccttgcagggtcctttctgctggcgcgccatatcaaaaaacaaatg
tttcagcttgagccacatgagattgtccgaatgtatgaagaacggacagcgacgtttcac
tcaatgaatgaaggcgtaattgccattgacaatcggctcatcattacaattttcaatgaa
aaagcgaaacagatctttgaggtgcaggggaatttggtcgggaaggtgatttgggacgtt
ctcaaggattcgcgcctgcccgaaatcgtggagcggaacaaagcggtttataatgaagaa
attcgcgtcagcggaaaggtcatcatgagcagcagaattccgattgtcatgaagaaaaaa
gtcatcggcgccgtcgctatttttcaggacagaacggaagccgccaagatggcagaggaa
ttgacgggcgtcaaaaactttgtggaggcgctccgcgttcaaaaccatgagcatatgaat
aagctgcatacaatcgccggcctcatccagctggggaaatctgaaaaagccttgcagctt
gcattccaggcatcaactgagcaggaaaatgtgactgaatttctgcaccgctcgattcaa
aatgacgccgcggcgggccttctattaagtaaaatcagaagaggaagggagctcggcatt
gctgttcatattgatgaaaacagcagccttcagcaatttcccgagcatgttgatcagcat
gatatcgtcgtgcttttggggaatctgattgaaaatgccttcggttcatttgaaaccgtt
caatctgatgataaacgaattgacatcagcatcgaacaaacggatgatatccttgctatt
ttaatagaagataacgggtgcgggattgaaccgacacacatgccgcacctttacgacaaa
ggatttacggtcaataaaacaggcggcacaggctatggcctgtatttagtaaaacaaatc
acagacaaaggatcgggcacgatagaagttgattcacacgcgggacagggaacatctttt
tctatcgtttttccaatgaagggggaggaagcacagcatgactcgtaa

DBGET integrated database retrieval system