KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0687Help
Entry
GYO_0687          CDS       T01635                                 

Gene name
ndoA
Definition
(GenBank) endoribonuclease EndoA
  KO
K07171  mRNA interferase MazF [EC:3.1.-.-]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Enzymes [BR:bst01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     GYO_0687 (ndoA)
Prokaryotic defense system [BR:bst02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   MazF-MazE
    GYO_0687 (ndoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PemK_toxin
Motif
Other DBs
NCBI-ProteinID: AEP85393
UniProt: G4NU33
Structure
PDB: 

Position
635700..636050
Genome map
AA seq 116 aa AA seqDB search
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHV
EIDAKRYGFERDSVILLEQIRTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
ttgattgtgaaacgcggcgatgtttattttgctgatttatctcctgttgttggctcagag
caaggcggggtgcgcccggttttagtgatccaaaatgacatcggaaatcgcttcagccca
actgctattgttgcagccataacagcacaaatacagaaagcgaaattaccaacccacgtc
gaaatcgatgcaaaacgctacggttttgaaagagattccgttattttgctggagcaaatt
cggacgattgacaagcaaaggttaacggataagattactcatctggatgatgaaatgatg
gataaggttgatgaagccttacaaatcagtttggcactcattgatttttag

DBGET integrated database retrieval system