KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0688Help
Entry
GYO_0688          CDS       T01635                                 

Definition
(GenBank) modulator protein RsbR
  KO
K17763  rsbT co-antagonist protein RsbR
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Transcription machinery [BR:bst03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     GYO_0688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rsbr_N STAS RsbRD_N KaiA
Motif
Other DBs
NCBI-ProteinID: AEP85394
UniProt: G4NW54
Structure
PDB: 

Position
636170..636991
Genome map
AA seq 273 aa AA seqDB search
MSNQTVYQFIAENQNELLQLWTDTLKELSEQESYQLTDQVYENISKEYIDILLSSVKDDS
AAESQISELALRAVQIGLSLKFLATALAEFWKRLYTKMNDKRLPDQESTELIWQIDRFFS
PINTEIFNQYSISWEKTVSLQKIALQELSAPLIPVFENITVMPLVGTIDTERAKRIMENL
LNGVVKHRSQVVLIDITGVPVVDTMVAHHIIQASEAVRLVGAKCLLAGIRPEIAQTIVNL
GIDLSQVITKNTLQKGIQTALEMTDRKIVSLGE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatcagactgtataccagttcattgccgagaatcaaaatgaactgctccaactg
tggactgacacactaaaagaattaagcgaacaagaatcatatcagctgactgaccaagtg
tatgaaaatatatctaaagagtatatcgacattcttctctcatctgttaaggatgacagc
gctgctgaaagccaaattagcgaactggcgcttagagccgtccaaatagggctttctttg
aagtttttggctacggcgctggctgaattctggaagcgtctctacacgaaaatgaacgat
aagagattgccagatcaagagagtacggaattaatctggcagatcgaccgctttttcagt
ccgattaatacagaaatctttaaccaatactcaatctcatgggagaaaacagtatccctg
caaaaaatcgcgctgcaggagttatcagctccgctcattccggtgtttgaaaacattacc
gtgatgccgcttgtcggaacaattgataccgaacgtgctaaacgaattatggaaaatctt
cttaacggcgtcgtcaaacatcggtctcaagtcgtgttaatcgatattacgggcgtgccg
gtcgttgatacgatggttgcccatcatattattcaagcgtctgaagcggtaaggcttgtc
ggagcgaaatgcctgctcgccggaatccgtccggaaattgctcagaccatcgttaacctg
gggatcgatttatcccaagttataactaagaataccctgcaaaaaggaattcaaacggct
ttggaaatgacagatcgaaaaattgtttcattgggggaataa

DBGET integrated database retrieval system