KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0689Help
Entry
GYO_0689          CDS       T01635                                 

Definition
(GenBank) antagonist protein RsbS
  KO
K17762  rsbT antagonist protein RsbS
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bst03021]
    GYO_0689
Transcription machinery [BR:bst03021]
 Prokaryotic type
  Bacterial type
   Other transcription-related factors
    RNA polymerase-associated proteins
     GYO_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: STAS STAS_2 NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AEP85395
UniProt: G4NW55
Position
636996..637361
Genome map
AA seq 121 aa AA seqDB search
MRHPKIPILKLYNCLLVSIQWELDDQTALTFQEDLLNKIYETGANGVVIDLTSVDMIDSF
IAKVLGDVITMSKLMGAKVVLTGIQPAVAVTLIELGIALEEIETALDLEQGLETLKRELG
E
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
ttgagacatccgaaaatcccgatcttgaaactgtataattgcttattagtgtccattcaa
tgggaactcgatgaccaaactgcattaacctttcaagaagacttattaaataaaatatac
gaaacaggcgctaacggagttgtcattgacctgacatctgtggacatgattgattccttt
atcgctaaagtgctgggcgacgtgatcacgatgtctaaactaatgggcgcaaaagtggtt
ttaacgggaattcagcctgctgtggcagttacgctgattgaactcggaatcgcacttgag
gaaattgaaaccgcgctcgacttagagcaggggcttgagacattgaagcgggaattgggg
gaatag

DBGET integrated database retrieval system