KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0694Help
Entry
GYO_0694          CDS       T01635                                 

Gene name
sigB
Definition
(GenBank) RNA polymerase sigma-B factor
  KO
K03090  RNA polymerase sigma-B factor
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bst03021]
    GYO_0694 (sigB)
Transcription machinery [BR:bst03021]
 Prokaryotic type
  Bacterial type
   RNA polymerase
    Sigma factors
     GYO_0694 (sigB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sigma70_r4 Sigma70_r3 Sigma70_r2 Sigma70_r4_2 HTH_23 GerE DUF1492 DUF134 HTH_16 IF2_N Phage_rep_O KORA HTH_37 DUF1292
Motif
Other DBs
NCBI-ProteinID: AEP85400
UniProt: G4NW60
Position
639621..640409
Genome map
AA seq 262 aa AA seqDB search
MTQPSKTTKLTKDEVDRLISDYQTNQDEQAQETLVQVYTNLVDMLAKKYSKGKSFHEDLR
QVGMIGLLGAIKRYDPVVGKSFEAFAIPTIIGEIKRFLRDKTWSVHVPRRIKELGPRIKM
AVDQLTTETQRSPKVEEIAEFLDVSEEEVLETMEMGKSYQALSVDHSIEADADGSTVTIL
DIVGSQEDGYERVNQQMMLQSVLHVLSDREKQIIDLTYIQNKSQKETGDILGISQMHVSR
LQRKAVKKLREALIEDPSMELM
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaccatcaaaaactacgaaactaactaaggatgaagtcgatcggctcataagc
gattaccaaacgaatcaagatgaacaggcgcaagaaacgcttgtgcaggtgtatacaaat
cttgttgatatgcttgcgaaaaaatattcaaaaggcaaaagttttcacgaggatctccgt
caggtcggcatgatcgggcttctcggcgcgattaagcgatacgatcctgtcgtcggcaaa
tcgtttgaagcttttgccattccgacaatcatcggtgaaattaaacgtttcctcagagat
aaaacgtggagcgttcatgtgccaagacggattaaagaactgggtccacgaatcaaaatg
gcggttgatcagctgacgactgaaacacaaaggtcaccgaaagtagaagagattgccgaa
ttcctcgatgtttcagaagaagaggttcttgaaacgatggaaatgggcaaaagctatcaa
gccttatccgttgaccacagcattgaagcggatgcggacggaagcaccgtcacgattctt
gatatcgtcggatcacaggaggacggatatgagcgggtcaaccagcaaatgatgctgcaa
agcgtgcttcacgtcctttctgaccgtgaaaaacaaatcatagaccttacgtatattcaa
aacaaaagccaaaaagaaactggggacattctcggtatatctcaaatgcacgtctcgcgt
ctgcagcgcaaagctgtgaagaagctcagagaggccttgattgaagatccctcgatggag
ttaatgtaa

DBGET integrated database retrieval system