KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0720Help
Entry
GYO_0720          CDS       T01635                                 

Definition
(GenBank) HTH-type transcriptional regulator LrpA
  KO
K03719  Lrp/AsnC family transcriptional regulator, leucine-responsive regulatory protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
Transcription factors [BR:bst03000]
 Prokaryotic Type
  Helix-turn-helix
   Lrp/AsnC family
    GYO_0720
Chromosome and associated proteins [BR:bst03036]
 Prokaryotic Type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    GYO_0720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_AsnC-type HTH_24 AsnC_trans_reg MarR PCI Herpes_UL36 MarR_2
Motif
Other DBs
NCBI-ProteinID: AEP85419
UniProt: G4NW79
Position
657826..658347
Genome map
AA seq 173 aa AA seqDB search
MISPFHFIFKVLSKHKKIVQRTNYVKYILFFQKGYKKMIDETDKKILDELSKNSRLTMKK
LGEKVHLTAPATASRVVKLLDNGIIKGCSIEVNQVKLGFSIHAFLNIYIEKIHHQPYLAF
IETQGNYVINNYKVSGDGCYLLECKFPSNEVLDQFLNDLNKHANYKVSIVIGK
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcaccatttcactttatttttaaagttttaagcaaacataaaaaaattgtacag
cgaacaaactatgtaaaatacatcttattttttcagaaaggatacaagaaaatgattgat
gaaacagataaaaaaatactcgatgagctgtctaaaaatagtcgccttacaatgaaaaaa
ttaggggaaaaagtacatctcactgcaccagcaaccgcatcaagagtagtaaagttatta
gacaatggcataataaaaggatgtagtattgaagtgaatcaagtgaaattaggcttctct
atacatgcttttcttaatatttatatcgaaaaaatccatcatcaaccttatttagctttt
atagaaacacaaggtaactatgtcataaacaattataaagttagtggagacggttgctat
ttgcttgaatgtaaattcccctcaaacgaggtattagatcaatttttaaatgacttaaac
aaacatgcaaactataaagtgtcgattgttattggtaaatag

DBGET integrated database retrieval system