KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0729Help
Entry
GYO_0729          CDS       T01635                                 

Definition
(GenBank) integral membrane protein
  KO
K08987  putative membrane protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    GYO_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1304
Motif
Other DBs
NCBI-ProteinID: AEP85427
UniProt: G4NW87
Position
666454..666825
Genome map
AA seq 123 aa AA seqDB search
MEIIATILVGIVALEHLFIMILEMFFIDSKAAKRAFKLPRHLEGDRNVAVMFANQGLYNG
FLAAGLIWGLILGLNPIGYMVQLFFVICVVVAAIFGGFTSNKSIIVKQGLPAILALVTLL
SVM
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
gtggaaataatcgcaactattttagtagggatcgtagcattagaacatttattcattatg
atccttgaaatgttttttattgattcaaaggcggcaaaacgcgcgttcaaattgccaagg
catttagaaggagatcgaaacgtagccgttatgtttgcaaaccaaggtttatataatgga
tttctagctgctggtctcatttggggacttatacttgggctcaatccaattggctatatg
gttcaattatttttcgtaatttgtgtggtagtagcagccattttcggaggtttcacatca
aataaatcaattattgtgaaacaaggacttccagctattttagcactagttaccctttta
tctgtgatgtag

DBGET integrated database retrieval system