KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0738Help
Entry
GYO_0738          CDS       T01635                                 

Definition
(GenBank) inner membrane transport protein YeaN
  KO
K03449  MFS transporter, CP family, cyanate transporter
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bst02000]
    GYO_0738
Transporters [BR:bst02000]
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Cyanate porter (CP) family [TC:2.A.1.17]
    GYO_0738
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 DUF485
Motif
Other DBs
NCBI-ProteinID: AEP85435
UniProt: G4NW95
Position
671527..672735
Genome map
AA seq 402 aa AA seqDB search
MSVQSDTKPTGLKRSLSLSWPIIIGIVLISLTMRSPLTSVGPLVGSIRESLGLSHTAAGL
LTTLPLLAFSLLSPFAPILARRFGMERIILYALVLLMAGIAVRSLTATVPLFAGTVLLGL
AIAVCNVLIPGLVKRDFSHNVGLMTGLYSVSMNLCGAIASGVSVPLARNLGFGWNGALGI
WGLLALVAALFWFPKVRASHASAMITTSGTSTRRNLWRSPLAWMITLFMGLQSLLFYVLI
AWLPEIMASRGLSEDSAGWMLSLFQFASLPVSFIVPIVAGRMKNQRLLVVMMTVLFFVSL
GGLYFGDNALILLWTILLGFAGGCAFSLAMIFLSLRTKDASDAASLSGMSQSVGYLLAAT
GPTLFGLLHDVTASWNFPILLLLMVSILLFIFGLGASKNHTV
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtacaaagtgataccaaaccaactgggttaaagcgttcgctctcattgagttgg
ccgatcatcataggcatcgtccttatatcattgacgatgcggtcaccgctaacgtcggta
ggcccactggtaggatcgattcgcgagtcccttggattatcgcataccgcggcaggcttg
ctcacgacattgccgttgcttgctttctcgcttctttcccccttcgcgcctatcttggcg
cgccgcttcgggatggaacggatcatactttatgcattggttcttctcatggcaggtatt
gctgtccgctcgctgaccgcaacagttcctttatttgcaggcaccgttttgcttgggctc
gcgattgcggtgtgcaacgtgctaattccaggtcttgttaaacgggatttttctcataat
gtcggtcttatgacagggctgtattcagtgtcgatgaatttatgcggtgcgatagcctcc
ggtgtaagtgtcccgctcgcccgcaatctcggttttggctggaatggcgcacttggaatc
tggggcctgctcgctctggtagccgcactattctggtttcctaaagtgcgggcgagtcac
gcgtcagccatgataactactagcggtacgtcgacgcggcgaaatctgtggcgttcaccg
ctggcatggatgattacactttttatgggattgcagtctctgcttttctatgttttgatc
gcttggttacctgaaatcatggcaagccggggcttgagtgaagacagcgctggttggatg
ctatcgctatttcaattcgcttcgcttcccgtatcattcatcgtaccgatcgttgcggga
cgcatgaagaatcagcgtttattggttgtcatgatgactgtcctgttttttgtttcattg
ggtggcctttatttcggcgataatgcactgattttgttatggacaattttactcgggttt
gctgggggatgtgcgttcagtttggctatgatctttttaagcttgcggacgaaagatgcc
tccgatgcggcttctttgtccggtatgtcgcaatctgttggatatttgctggctgcaaca
ggaccgacattgtttggtttgctccatgatgtcacggcaagctggaacttcccaatatta
ctgttgcttatggtcagcattctgctgttcatattcggcctgggtgcgtcaaaaaatcac
acggtataa

DBGET integrated database retrieval system