KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0742Help
Entry
GYO_0742          CDS       T01635                                 

Definition
(GenBank) YdeI
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OmdA DUF1801 S10_plectin
Motif
Other DBs
NCBI-ProteinID: AEP85439
UniProt: G4NW99
Position
676472..677065
Genome map
AA seq 197 aa AA seqDB search
MTNNRTNPKVDEFLSKAKKWKEEYEKLRAIVLDCELTEEFKWKHPCYTLNNKNIVLIHGF
KEYCALLFHKGALLQDAHGILIQQTENVQAARQIRFTNVQEIDEMETILKAYIHEAIEVE
KAGLEVDLKKNTEYKIPEELQNKFDEIPALKTAFEALTPGRQRAYILHFSQAKQSKTRES
RVEKYVQKILDGKGLKD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacaaataacagaacgaatcctaaggttgatgaatttttaagtaaagcgaaaaagtgg
aaggaagaatatgagaagttgagagctatcgttcttgactgtgagctgactgaagaattt
aagtggaagcatccttgctacacgcttaataataagaacatcgttttaatacatggattt
aaagaatattgtgcgcttctgtttcacaaaggtgccttgttacaggatgcccatgggatt
ctcatccaacaaacggagaatgtacaggcggcacgccagattcggtttaccaatgttcag
gaaattgatgaaatggaaacgatcttgaaagcctatattcatgaggccattgaagttgaa
aaagccgggttggaagtggatttaaaaaagaatacagaatataaaattcctgaagaactt
caaaataaattcgatgaaatccctgccttgaaaacagcttttgaagcattgacgccagga
cggcaaagagcatatattcttcatttttctcaagccaaacaatccaaaacccgagagtca
agggttgaaaaatatgtgcaaaaaattctcgatggaaagggattaaaggattag

DBGET integrated database retrieval system