KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0749Help
Entry
GYO_0749          CDS       T01635                                 

Definition
(GenBank) hypothetical protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEP85446
UniProt: G4NWA6
Position
681966..682100
Genome map
AA seq 44 aa AA seqDB search
MRFYDLNGNTDEKKTKPLLDPVDIFLSLAKECQADDEEYRAHLI
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcttttacgatctcaacgggaatacagatgaaaaaaagaccaagccattgcttgat
ccagttgatatatttctctcactagcgaaggaatgccaagctgatgatgaagaatatcgt
gcacatctgatatga

DBGET integrated database retrieval system