KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0752Help
Entry
GYO_0752          CDS       T01635                                 

Definition
(GenBank) transporter, dme family
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-ProteinID: AEP85449
UniProt: G4NWA9
Position
complement(683932..684795)
Genome map
AA seq 287 aa AA seqDB search
MNKTTNGWINGFIGVLIFSGSLPATRLAVTDFNPLFLTVCRAAIAGVLAGCLLLIFRQQH
PAKRDIISLLVVAFGVVIGFPLLTALALQYVTSAHAIVFVGLLPLATAIFGVLRGGERPR
PVFWIFSAAGSLLVAGFALIQGGGSSPLGDAYMLASIVVCGLGYAEGARLSRRLGNWQVI
SWALVLSLPLMLPLSFFFTPDSWSGIGVPALLSLAYVSLFSMLIGFVFWYRGLAQGGIAA
VGQLQLLQPFFGLLLASVILHEKVGWALVAVNIAVIMCVAAARRFAK
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaacaacaaatggctggataaatggttttataggcgtactcattttcagcggc
tcgctgcctgcaacccgcttggcggtgacggacttcaacccattgttcctcaccgtatgc
cgcgctgcgatagctggtgtattggctggatgtctcctactcatcttccggcagcagcat
cctgccaaaagagacatcatttcactattggtggtagcattcggcgtagtaatcggtttc
ccgttgctgacagccttagcacttcagtatgtcacatccgcacatgccattgtcttcgtt
gggcttcttccgctcgcgacggcgattttcggtgtactgcgcggaggcgaacgcccccgc
ccagtcttctggattttctcagctgctggcagcttactagtagcagggttcgctctgatc
caagggggaggatcatccccgctcggcgacgcgtacatgctggcttctatcgtcgtatgc
ggtcttggttatgcagaaggtgctaggctttcacggcgtctggggaattggcaggtgatc
tcttgggcactcgttctgtcgcttcctcttatgctgcctttgtcgttcttttttacaccg
gactcatggtcaggcatcggcgttcctgcgctgctcagtcttgcctatgtgtccttattc
agcatgctgatcggcttcgtgttctggtatcgaggtctcgcccaaggcggaattgcggcg
gttggtcagctgcagcttctccagcctttctttggactgctgcttgcctcagtgattctg
cacgagaaagtgggctgggcgctcgtggcagtgaatatcgccgttatcatgtgcgtggct
gctgctcggcgatttgcaaagtaa

DBGET integrated database retrieval system