KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0755Help
Entry
GYO_0755          CDS       T01635                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K07002  uncharacterized protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Brite
KEGG Orthology (KO) [BR:bst00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    GYO_0755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ser_hydrolase Abhydrolase_6 LCAT DUF900
Motif
Other DBs
NCBI-ProteinID: AEP85452
UniProt: G4NWB2
Position
complement(687102..687674)
Genome map
AA seq 190 aa AA seqDB search
MTKQVYIIPGYRASSTNHWFPWLKKRLLADGVQADILNMPNPLQPRLEDRLDTLSFYQHT
LHENTYLVAHSLGCPAILRFLEHIQLRKQLGGIILVSGFAKSLPTLKILDEFTQGSFDHQ
KIIESAKHRAVIASKDDQIVPFSWSKDLAQQIDAALYEVQHGGHFLENEGFTSLPIVYDV
LTSYFSKETR
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaagtctatatcattcctggctacagagcctcctcaacaaatcattggttc
ccttggctgaaaaaacgtctgctcgcagatggggtccaagcagacattttaaacatgcct
aatccgctccagccaagacttgaggatcggctggatacactctctttttatcaacacact
ttacatgaaaatacgtatttggttgcgcacagcttagggtgccccgccattttgagattt
ttggaacatattcaattacgaaaacaacttggcggaatcatacttgtttccggctttgcc
aaatcattgcccactttaaagatattagatgaatttacacagggatcgtttgatcatcaa
aaaatcatcgagtccgcgaagcaccgtgctgtcattgcttctaaggacgaccaaattgtt
ccattttcatggagcaaggatctggcacaacaaattgacgctgcgttatacgaagtccag
cacgggggtcattttctagaaaatgaagggtttacttctttgcctattgtttatgatgtt
ttaacctcttatttttcaaaagaaactcgctaa

DBGET integrated database retrieval system