KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0765Help
Entry
GYO_0765          CDS       T01635                                 

Definition
(GenBank) YheN
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_deac_1 DUF2334 IBP39
Motif
Other DBs
NCBI-ProteinID: AEP85462
UniProt: G4NWC2
Position
complement(695080..695910)
Genome map
AA seq 276 aa AA seqDB search
MSNSPRRDRKLNQIGKIGFGILIILGVTLLCISWKALAGPKQEPIKESAATSEQMHKDKN
KNTAQKKEEQKTSPEIGKVVYLTFDDGPNPAASEKIMDLLHKYNAKGTFFMLKPNIERNP
ALVRKMVESGHSVGSHGVTHQVSEIYKSPESFATEMNDTLNYIKDTTKVNTHLIRAPYGS
KPYITGPFREVVKRDHFNLWDWTVDSEDWKYTHGEFVKNTIQQVNNLVGKEPLVVLMHEK
PTTAAYLEELLKYFRESGYDMKAIHDSIKPVQFRFN
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaattcaccaagaagggaccgtaaattaaatcaaataggcaaaataggttttggg
atattgattattctaggtgtcactttattatgcatttcttggaaagcacttgctggtcca
aagcaggaaccaataaaagaaagtgccgctacttctgagcaaatgcacaaagataagaac
aaaaatacagcacagaaaaaggaggaacaaaaaacatcacctgaaatcggaaaggtggtc
tatttaacatttgatgacggaccaaaccctgctgcatcagagaaaattatggatttgctc
cataaatacaatgctaaaggaacgtttttcatgttaaaacctaatatcgagcgaaatcct
gctcttgtgagaaaaatggtagaaagcggtcactctgttgggtctcacggcgtgacgcat
caggtttccgaaatctataaatcccctgaaagctttgcgacagaaatgaacgatacgctg
aactatatcaaagatacaaccaaagtcaacacacatttgatacgagcaccttacgggtca
aagccttacattacaggcccatttagagaagttgttaagcgtgatcattttaatctatgg
gattggacagttgattcagaagactggaaatacactcacggcgaatttgtaaaaaataca
attcaacaagtaaacaatcttgtagggaaagagccgcttgttgtattaatgcatgaaaaa
ccgactactgcggcatatctagaagaattattaaaatatttccgcgaaagcggctacgac
atgaaagcaatccatgattcaataaagccggtacaattcagattcaattga

DBGET integrated database retrieval system