KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0770Help
Entry
GYO_0770          CDS       T01635                                 

Definition
(GenBank) transcriptional regulator, GntR family
  KO
K18907  GntR family transcriptional regulator, regulator for abcA and norABC
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Module
bst_M00700  Multidrug resistance, efflux pump AbcA
Brite
Transcription factors [BR:bst03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    GYO_0770
Antimicrobial resistance genes [BR:bst01504]
 Gene sets
  Multipdrug resistance modules
   Multidrug resistance, efflux pump AbcA [MD:M00700]
    GYO_0770
   Multidrug resistance, efflux pump NorB [MD:M00702]
    GYO_0770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 GntR Aminotran_MocR HTH_36 HTH_Crp_2 HTH_11 MarR_2 Rrf2 Sec20 MarR TrmB Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEP85467
UniProt: G4NWC7
Position
700715..702163
Genome map
AA seq 482 aa AA seqDB search
MSFPEEKKTKKLPKYRQIVHFIKEKIGNGEWPIGSQIPSQRTLAKDFQVNRSTVITALEE
LMADGLIEGRMGKGTVVINNTWTLLAKNSAPNWDQYVTSGIQQPSQKIVQEINQSESNMD
LIQLSKGELSTEIFPLTAMKEMMGKVSQNMEAFGYEEPKGYFPLREALSNYLRTFGINAS
SSSILIVSGALQALQLISMGLLQRGSTVYLDQPSYLYSLHVFQSAGMKLTGLPMDNEGLL
PGNLHITRGERGRAILYTNPCFHNPTGILMSQKRREEIIAASENTQLPIIEDDIYRELWI
DEIPPYPIKTIDKNGHVLYIGSLSKTLSPGLRIGWIVGPEPVIERLSDIKMQTDYGSSSL
SQRVAAEWFTSGQYQQHLEKVRQQLKVRRELALSALETHLKDVATWNMPKGGFFVWIKIL
PSISMKLLYTKALSKGILLNLGSIYAQEKGNYVRLSYAYASLEDLQKGIYELGLMIKELA
SK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgagctttccagaagaaaaaaagacgaaaaagcttcctaagtacagacaaatcgttcat
tttattaaggagaaaataggaaatggagagtggccgattggaagccagattccaagccag
cgcacgcttgcaaaagactttcaggtaaatcgaagcacagtgattacggccttagaggaa
ttaatggcagatgggttaatagaaggcagaatggggaaaggcacagttgttatcaacaat
acatggacactattagctaagaattctgctcctaattgggatcaatatgtaacctctgga
attcagcagcctagccaaaaaatcgtacaggagataaaccaatcagaatcaaatatggat
cttatacagctcagtaaaggcgaactttcaactgagatttttcctttaactgctatgaaa
gagatgatgggcaaggtatctcaaaacatggaagcattcggatatgaggaaccaaaagga
tattttccgttgagagaggcattaagcaactatttaagaacctttggcatcaatgcctca
tcttcttccattctaattgtttcgggagcattgcaagccctgcagctgatatcgatgggg
cttttgcaaagaggatcaaccgtttatcttgatcagccatcttacctttattcattacac
gtatttcaatcagctggcatgaaactgaccgggcttcctatggataatgagggacttttg
ccgggaaatcttcatatcacaagaggggaacggggaagggctatattatatacaaatcct
tgttttcataatccgaccggtattttaatgtcgcaaaagcggcgggaagaaatcattgca
gctagtgagaatacacagcttcccattattgaagatgacatttatcgcgagttatggata
gatgaaattccgccctatcctattaaaacaatagataaaaatgggcatgtgctatacata
ggcagtttatcgaaaacattgagtccgggcttgaggattggatggatagtcggaccagaa
ccggtgattgaacgtttatctgacattaaaatgcaaacagattacggatccagttcatta
tcccagagagtagcggcggagtggtttacatccggccaataccagcagcatttagaaaag
gttagacagcaattaaaggtgagaagagaattggccttgagtgcattagaaacccatttg
aaggatgttgcgacatggaacatgccaaagggagggttctttgtctggataaaaatattg
ccttcaatatcaatgaaattactttatactaaagctttatcaaaagggattcttctcaat
ctcggcagtatctatgctcaggaaaaagggaattatgttcgcttatcatatgcttatgca
tcccttgaagaccttcaaaaggggatttatgagttgggtttaatgataaaagaattggca
agtaagtaa

DBGET integrated database retrieval system