KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0772Help
Entry
GYO_0772          CDS       T01635                                 

Definition
(GenBank) transcriptional regulator, ArsR family
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_20 HTH_5 MarR HTH_34 MarR_2 Mnd1 HTH_24 HTH_Crp_2
Motif
Other DBs
NCBI-ProteinID: AEP85469
UniProt: G4NR00
Position
702995..703675
Genome map
AA seq 226 aa AA seqDB search
MNPNIAKISSLLSDPSRSSILLTLMDGRIHPAGELAYLANIKPQTASFHLKKLLEEKLIS
VEKHGRHRYYRLSNSDTANMIEQLLRMAPKAKVTSLKDSKEKSDLHFARTCYDHLAGYVG
VQMTHSLVEQGILKKVDLNFEVTSEGSLFFSKLGINEEHQRHKRRAFARCCLDWSERQHH
IAGALGNALLVRMLEEEWIVRMPKTRAVRMTQSGKTAFEKYFKVNI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctaatatcgcaaaaatctcatcgttgctatctgatccctcgcgttcttccatt
cttctcaccctaatggatggaaggatacaccctgcgggagagcttgcatatctcgcgaac
attaaacctcaaaccgcaagttttcacctgaaaaaattgcttgaagaaaagctgatcagt
gtagagaagcatggaagacatcggtattacagattgtctaactctgatactgcaaacatg
attgagcaattgcttcgtatggcgcctaaagccaaagtcacatctttaaaagattcaaaa
gagaaaagtgacttgcatttcgcccgaacctgttatgatcatctggcaggttatgtgggt
gtgcaaatgacacattcactagttgagcagggaatattaaaaaaagtcgatttaaacttt
gaggtgacttcagagggttctttgttcttttcgaagttaggcatcaatgaagagcaccaa
cgacataagaggagagcatttgcccgctgctgtttggattggagtgagcggcagcatcat
attgcaggggcgttaggaaacgccttattggtgcgcatgttagaagaagaatggatcgtt
cgtatgccgaaaacgagagcggttaggatgacacaaagcgggaaaaccgcatttgagaaa
tacttcaaagtgaatatttag

DBGET integrated database retrieval system