KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0773Help
Entry
GYO_0773          CDS       T01635                                 

Definition
(GenBank) alkylhydroperoxidase AhpD core
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CMD
Motif
Other DBs
NCBI-ProteinID: AEP85470
UniProt: G4NR01
Position
complement(703740..704183)
Genome map
AA seq 147 aa AA seqDB search
MSQRVSYYDVAPEGMKMMMDMEKYTKQSSINRTTRELIKIRVSQINGCAFCLDMHTSDAR
KMGETEQRIYCLHAWNECDFYSPEEKAALELSEHITLIPSKRVPDELYHRVREHYDEKQY
VDLVLIINQINSWNRISIAMGNQATSR
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgagtcaaagagtgtcctactatgatgttgcacctgaaggtatgaagatgatgatggat
atggagaaatacacgaaacaatcttcaattaaccgaacgacgagagagctaattaaaatc
agagtttctcaaataaacggctgtgctttctgcttagatatgcatacttctgatgcccgc
aaaatgggcgaaactgaacagcgaatttactgtttacatgcttggaatgaatgtgatttt
tattcacctgaagagaaagcagcgctcgaactatctgaacacatcacgctcattccctct
aaaagggttcctgatgagctgtatcatcgagtgcgagaacattacgatgaaaaacaatat
gttgaccttgttctcatcatcaatcaaataaacagttggaatcgcatctctattgcaatg
ggtaatcaagcaacttcgagataa

DBGET integrated database retrieval system