KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0778Help
Entry
GYO_0778          CDS       T01635                                 

Definition
(GenBank) mmpl family
  KO
K11625  membrane protein YdfJ
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bst00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GYO_0778
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL Sterol-sensing Patched
Motif
Other DBs
NCBI-ProteinID: AEP85475
UniProt: G4NR06
Position
706866..709037
Genome map
AA seq 723 aa AA seqDB search
MSRMLYKLGGWVARNRIKVICAWIVVLVASVGLAITLKPSFSEDMSIPDTPSEKAMDIIQ
KEFPHGPDKGSIRVIFGAEDGEKLTAESAKKAIENTFKEINKDDSVDSIASPFVTGTIAK
DGTVAYADIKYKSSADDIKDYSIKHLKDSLKLADDEGLQTELSGDVPGAEMEIGGVSEIV
GIILAFVVLAITFGSLLIAGLPILTALIGLGVSIGLVLIGTQVFDIASVSLSLAGMIGLA
VGIDYALFIFTKHRQFLGEGIQKNESIARATGTAASAVVFAGLTVIVALCGLTVVDIPFM
SAMGLTAGLSVLLAVLASITLVPAVLSIAGKRMVPKSNKKKEKQSAETNVWGRFVTKNPI
MLSVCSILILLVISIPSMHLELGLPDAGMKAKDNPDRRAYDLLADGFGEGFNGQLTIVAD
ATSVTENKAEAFADAVKEIKELDHVASVTPAMPNKEGNFAIITVVPTTGPNDAATKDLVK
DVRSLSDKNRVDLLVTGSTAVNIDISDRLNDAIPVFAVLIVGFAFVLLTIVFRSLLVPLV
AVAGFILTMTATLGICVFVLQDGNLIDFFKIPEKGPILAFLPILSIGILFGLAMDYQVFL
VSRMREEYVKTKNPVQAIQAGLKHSGPVVTAAGLIMIFVFAGFIFAGEASIKANGLALSF
GVLFDAFIVRMTLIPSVMKLMGNAAWYLPKWLDKIIPNVDIEGHQLTKEIQPEIDHEQKK
QIM
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgtctagaatgttatataaattaggaggatgggttgctcgcaatcgcataaaagtaata
tgtgcgtggatcgttgtgttagttgcttcggtaggccttgcaatcacgttaaaaccaagt
ttttctgaggatatgtccatacctgacacaccttcggaaaaagcgatggatatcattcaa
aaagaatttcctcacggtcctgataaagggagcatacgggtgattttcggagctgaagat
ggagagaaacttactgcagagtcagccaaaaaagcaatcgaaaatacgttcaaggaaatc
aataaagatgattctgttgactcgattgcaagtccttttgttacaggaacaatcgcgaaa
gatggcaccgttgcctatgctgatatcaagtataaatcttcagcagatgatataaaagat
tactctatcaaacacttaaaagacagtttgaaattggctgatgacgagggattacaaact
gagctaagcggagatgtaccaggagccgagatggagataggtggagtgtctgaaattgtc
ggcattattttggcctttgtcgttttagccattacattcggctccttattaatagcaggt
ttgccgattttaactgcactgattggattaggtgtaagtattggacttgttttgattggg
acacaagtatttgatattgcttccgttagtctttcattagccggaatgattggccttgct
gttgggattgattatgctttatttatttttacgaagcaccgccagtttttaggcgaaggt
atacaaaaaaatgaatcaatcgcgagagctacaggaacagctgcgagtgcagttgttttt
gccggacttactgttatcgtcgcactttgcggattgactgtcgttgacattccttttatg
tctgcaatggggctgacagcagggcttagtgtattgttagctgtcctcgcttcaatcacg
cttgtgcctgccgtcttgtcgatagcggggaaacggatggttccgaaatcaaacaagaaa
aaagaaaaacaaagcgctgaaacaaatgtctggggacgctttgtcacaaaaaatcctatc
atgctaagtgtatgcagcattctcattttgcttgttattagtatcccatctatgcatttg
gagctgggcttgcctgatgcagggatgaaagcgaaggataatccagatcgtcgggcttat
gacttgcttgccgacggttttggagaaggatttaatggtcaattaacaatcgtagcggat
gccacaagtgtaacagaaaataaggcggaagccttcgcagatgcagtgaaagaaataaag
gaactagaccatgtagcgagtgtcacgcctgcaatgcctaataaagaagggaactttgcc
atcattacggtagttcctacaacaggtccaaatgatgcagcaacgaaggatttggtaaag
gatgtacgcagcttatcagataaaaatagggtagatttgctcgttactggatcgactgca
gtgaatattgatatttcagatcgccttaatgatgcgataccggtgtttgctgtactcatt
gttggttttgcgtttgtattgctgacaatcgtattccgttcgttgcttgtgcctcttgtt
gctgttgcgggtttcatattgacgatgacagccactcttggaatctgtgtatttgtttta
caagacgggaatctcatcgactttttcaaaatacctgaaaaagggccgatactcgcgttc
ttgccgattttatctattgggatactgtttggattagccatggattatcaagtattcctt
gtaagcagaatgcgtgaagaatatgtgaaaacaaagaatccagtacaagcgattcaagct
ggattaaaacacagcggtcctgttgtcaccgcagccggcctgatcatgatattcgttttt
gctggatttatctttgctggtgaagcttctattaaagccaacggattggctctttccttt
ggtgtgctctttgatgcatttattgtacgaatgacactgattccaagtgtcatgaagctg
atggggaatgcagcctggtatttgccaaaatggctagacaagattattccgaatgtggac
atagaagggcatcaactcacgaaggaaatacagccagaaatagatcatgaacaaaagaaa
caaatcatgtaa

DBGET integrated database retrieval system