KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0781Help
Entry
GYO_0781          CDS       T01635                                 

Definition
(GenBank) hypothetical protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: AEP85478
UniProt: G4NR09
Position
709742..709912
Genome map
AA seq 56 aa AA seqDB search
MVLYFNIQRIIVILTMILFFVWILYGTLNMLLKGVNQKGDQKWAVFRSAFRYTIPI
NT seq 171 nt NT seq  +upstreamnt  +downstreamnt
atggttctctattttaatatacaaagaatcattgtcatccttacaatgatcttgtttttt
gtatggattttgtatggtacattaaatatgttgctcaaaggtgtgaatcaaaaaggagat
caaaaatgggctgtatttcgttcggccttccgatatacgattccgatttag

DBGET integrated database retrieval system