KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0802Help
Entry
GYO_0802          CDS       T01635                                 

Definition
(GenBank) YdgC
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TetR_N DUF4971 TetR_C_4
Motif
Other DBs
NCBI-ProteinID: AEP85496
UniProt: G4NR27
Position
722061..722660
Genome map
AA seq 199 aa AA seqDB search
MKSKKGRKGEESRKRLLNAAANEFAIWGFHETKVSEIVKRAGLTQPSFYLYFQSKEAIFE
ELINDFHSRVRKLTESLLLENGLHTEDVSKRVLSAVETVFQCLAEDKDVTKIGFFLNPEA
KQMKKDLAMALKENLEAEQRLGYFHSELDMETVAECLIGMIEHLTDSFLLTGIKDPASLA
AEVVNLLIYGMLPKGSDVR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaagcaaaaaaggacgtaaaggggaagaaagccggaaacgattacttaacgctgct
gctaatgaatttgcgatttggggatttcatgaaacgaaagtaagtgaaattgtgaaaaga
gcgggactgacgcagccttccttttatctgtactttcaaagcaaagaagcgatctttgag
gagttaatcaacgattttcactctcgtgtcagaaagctgacagagtcactcctcctagaa
aacggattacacacggaggatgtgtcaaaacgggtgctgtctgctgtggaaactgttttt
caatgtctggctgaggacaaggatgtaaccaagatcggcttttttctcaacccagaggcg
aaacaaatgaaaaaagacttggcgatggctttgaaagaaaacctagaagcagaacagcgg
cttggctattttcactccgagctggacatggaaacggtcgctgagtgtttgatcggcatg
atcgaacatttaacggattcctttttgttaaccggaataaaagatccggcaagcctcgcc
gcagaggttgtaaatcttttaatatacgggatgctcccaaaagggagtgacgtaaggtga

DBGET integrated database retrieval system