KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0810Help
Entry
GYO_0810          CDS       T01635                                 

Definition
(GenBank) D-Tagatose 3-epimerase, putative
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2 PRMT5_TIM
Motif
Other DBs
NCBI-ProteinID: AEP85502
UniProt: G4NR33
Position
727861..728682
Genome map
AA seq 273 aa AA seqDB search
MGREYGLCLWTFGSIPFEQKCRLAAEIGVDGVEVEGDISLNPKELAETLAAHHVKVLSVT
PRNVDISSTNEEVRSKAVQYFLDLLDWAVDLGAPRICLHGDVGKVRGSGDDERDWSLLVE
SSKKIMAKAEELQIQVVFEVLNRYENHQVVTGEEALQFIRDVGSSKLDVLLDAYHMNIEE
ADPVKAIEMTGQKLGVYHVADSNRQAIGNGHANLKEQIEALHSIGYKGPIIMEMVAAGPD
PFTPVKGNSYLEVVTGYFKSSLETLRSWEGLKI
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgggaagagaatatgggttatgcttatggactttcggcagcattccatttgaacaaaaa
tgccggctggctgcagaaatcggagtagacggagttgaggtcgagggggatatttctctg
aatccgaaagagcttgccgaaacactggctgctcatcatgtaaaggttttatcggtaacg
ccaaggaatgtggatatttcaagcacgaatgaagaggttcggtcaaaggctgtacaatat
ttcttggacttactggactgggctgtggatttaggcgctccccgtatctgtcttcacggt
gatgtcggcaaagtgagagggagcggtgatgatgagagggattggagtttattggtcgaa
agctctaaaaagattatggctaaagcggaggaattacaaattcaggtggtattcgaagta
ttgaaccggtacgaaaatcatcaagtggtcactggcgaagaagctctacaattcatacgt
gatgtcggcagttccaaactcgatgttcttctcgatgcgtatcatatgaacatagaagag
gctgatcctgtgaaggccattgaaatgacagggcagaaactcggagtctatcacgtggct
gattcaaatcgccaggccatcggaaacggccatgccaatctgaaagagcaaatcgaagca
ctccattctatcggttataaaggcccgattattatggagatggtggcagccggtcctgac
ccttttactccggtaaaaggaaatagctatctggaagtggtgacggggtactttaagtca
tctctagagacattaaggtcatgggaaggtttgaaaatataa

DBGET integrated database retrieval system