KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0811Help
Entry
GYO_0811          CDS       T01635                                 

Definition
(GenBank) quinolone resistance NorA protein
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like MFS_2 Sugar_tr MFS_3
Motif
Other DBs
NCBI-ProteinID: AEP85503
UniProt: G4NR34
Position
728935..730137
Genome map
AA seq 400 aa AA seqDB search
MEVQVEKIHTAKMWSLSFIFVTLSNAFLFMVFEMLLPTLPLFVTAIGGGAKQVGLVTGIF
MISAIAIRPFAGVLAKRFNKKYLLIFGIVISACSTGAYYLASDVSVLLLIRLIHGAGFGL
ATTYFATIAAEIIPKERRGEGIGYFGVGETIAVSVGPMIGIAALELYDFERLFLGGMSIL
LLAVLMAALVRRRPEAKDTAEKGMVKVKVLERRVLFPSFLILLVGIAASGIMSFFSLYAI
EKGFRSVGMFFFLIAAASFFIRLISGKVFDRFGAAAILIPASISSIAGLSILYIAQTNAM
FFTAAICYGFGFGSIFPAIQTWCINLVEEHEHEDAMGTFFNFFDMGIGGGSLLLGVVATI
YSYQELYIASVLVYLLFLLLYILFICSKRKRRNNVGRAEQ
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atggaggtacaagtagaaaaaatacatactgcaaaaatgtggtccttatcatttattttt
gtcacactttcaaatgcctttttatttatggtgtttgaaatgttattgccgacattgcca
ttgtttgtaactgctatcggaggaggggcaaagcaagtcggattggttacaggtattttt
atgatatctgccattgccatacgtccttttgcaggggttttggcaaaacgatttaataaa
aaatatttacttatatttggaattgttatcagtgcctgctcaaccggtgcatattatttg
gcgtcagatgtgagcgtcctattgctcattcgcttaatacatggtgccggttttggatta
gcaactacttattttgccacgattgccgcggaaattattccgaaggagcgccgaggtgag
gggattggatattttggggtaggcgaaacgattgcagtttcggttggacctatgattggt
atcgcagcactggagctttatgattttgagaggctttttctaggcgggatgtccattctt
ttactggctgtgcttatggctgcacttgtgcggaggcggcctgaagcaaaagatacggct
gaaaagggaatggtaaaggtaaaggtgttagaaagacgtgtgctgtttccttcgtttctt
attttattagtaggcattgctgcatctgggatcatgtccttcttttcactctatgcgatc
gaaaagggtttccgaagtgtcggaatgttcttctttctgattgcggcagccagttttttt
atacgtcttatctccgggaaagtatttgaccgattcggagcggcagccatccttattccc
gcatcaatatcttcaatagcaggcctttcaatattatatattgcccaaaccaatgcaatg
ttttttactgcggcaatatgttacggttttgggttcggctcaatatttccggctatccag
acatggtgtatcaatcttgtagaagagcatgaacatgaggatgctatggggacattcttt
aatttttttgatatgggtattggcggaggctcgttgttattaggtgtggtggcaacgatc
tattcttatcaggagctttatatcgcttccgttttggtgtacctgctgtttcttttatta
tatattttatttatctgttccaagagaaaacggagaaataatgtagggagggcagaacag
tga

DBGET integrated database retrieval system