KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0815Help
Entry
GYO_0815          CDS       T01635                                 

Definition
(GenBank) DNA damage inducible nuclease inhibitor DinB
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DinB DinB_2 DUF664
Motif
Other DBs
NCBI-ProteinID: AEP85507
UniProt: G4NR38
Position
complement(734246..734764)
Genome map
AA seq 172 aa AA seqDB search
MSDFSLQLYEYNVWANQQIFNRLKELPKEVYRQEIQSVFPSISHVLSHVYLSDLGWIEVF
SGQSMTDALALAEQLKEQTEAKEMEEMEALFLTLSERYTLFLQQKEQLNKPLQIQNPSGG
IMKTTVSELVPHVVNHGTYHRGNITAMLRQTGYPSAPTDYGLYLYMKKTEMA
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatttttcattacaattgtatgaatataacgtctgggccaatcagcaaatattc
aaccgattaaaagagcttccaaaagaagtatatcgccaagaaattcaaagcgtgtttccg
tcgatatcccatgtgttgtctcatgtttatctttctgatctcggctggattgaagtgttt
tccggccaaagcatgaccgatgctttggcattagctgaacagctcaaagaacagacagag
gcaaaagaaatggaggaaatggaagccctgtttctgacgttatccgagcgctatacatta
tttttacagcaaaaagaacagctcaataagccccttcagattcaaaacccctcaggcgga
atcatgaaaacgactgtttctgagctggttccccacgttgtcaatcacgggacttaccac
cgcggcaatatcacagcaatgctgcggcagacaggctacccatccgctccgacagattat
gggctctacctgtatatgaaaaaaacagaaatggcataa

DBGET integrated database retrieval system