KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_0817Help
Entry
GYO_0817          CDS       T01635                                 

Definition
(GenBank) mmpl family
  KO
K06994  putative drug exporter of the RND superfamily
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MMPL IFT57 FliJ TMPIT Reo_sigmaC Spc7
Motif
Other DBs
NCBI-ProteinID: AEP85509
UniProt: G4NR40
Position
735386..738043
Genome map
AA seq 885 aa AA seqDB search
MRAIIKFKWAIAAVILVLTVVLSLFSPNLTELANQKGQAQLPADAVSERANAILKQAGED
NNSISIVFTLDHALKEETEDQLRTMIDKVKKIDGVEEVTSPLTAEKEVKDQLISKDKKTV
LIPVTITGSDKKAEKIADDIYTIVPDDVTAYITGASLINQDFAHSSEEGLKKTEVITVCL
IIGLLLIVFRSVVTPFIPIVVVGFSYLISQSILGILVYNVDFPISTFTQTFLVAILFGIG
TDYCILLLTRFREELANGHDKKEAALIAYRTGGKTLFISGFAVLIGFSALGFAKFAIFQS
AVGVAVGVGILMIILYTLLPLFMVTLGEKLFWPSKKVLSHSDNKLWAFLGRYSVVRPFLF
IVITVIITLPFILTYDDQISFDSTAEISSDYKSVKALEAIKDGFGEGKAFPINVVVKGDK
DLTTADTIPYLGNISKAIEKVEHVDSVMTITQPTGEKIKDLYIDKQLGTVSDGLDKTVKG
ITDVQSGLTDIENGLNQMAGQTGSASNSRSGGSLGDAADGLGKINQQLQLVSKQISQTGN
TAQTVQQLTAISGQLGQIQTGLEQANQQLSGQQAEAGTLTESLKKLAGGVKSANDGLTKI
SDGITASSDMLEDMSKSSTVRNTGIFIPDQVMKDKDFKKSIDQYSFADGKGVQLSVVLDS
NPYSEQAIATINQIKKAVANEVDGTPLEDAQIVYGGVTSVNADLKELSTTDFSRTMVIMI
IGLFIVLTILFRSMIMPIYMIASLLLTYYTSISITELIFVNGLGNAGVSWAVPFFSFVIL
IALGVDYSIFLLDRFKEEVHLGIAQGVVRSMSKMGSVIITAAIILAGTFAAMMPSGVNTL
MQVASVIIIGLLLYGLVILPLFIPAIIMTFGEGNWWPFGRKKIKE
NT seq 2658 nt NT seq  +upstreamnt  +downstreamnt
atgagagcaatcatcaaattcaagtgggcaattgcagcggttatattagtacttaccgtc
gttttgagtttgttttctccgaacttaacggagctggccaatcaaaaggggcaggcccag
cttcctgcagatgctgtttcagaaagagcaaatgccattttaaaacaagcgggagaagac
aataattcgatcagtatagtctttacattagaccacgctttgaaggaagaaacagaggat
cagctccggacaatgatcgataaagtcaaaaagatcgacggtgtagaagaagtaacgtct
cctctgacagcggaaaaagaagtcaaagaccaattgatttcaaaagacaagaaaacggtt
ctcattcctgtcacgattacaggttctgataaaaaagcggaaaaaatcgcggatgacatt
tatacaatcgttcctgatgatgtgacggcatatattacgggagcctctcttatcaatcag
gatttcgctcacagctcagaggaagggctcaagaaaacggaagtgatcacagtctgcttg
atcattggtttactgctgatcgtgttccgatctgttgtgacgccgtttatcccgattgtg
gttgtcggtttctcttatctgatcagtcaatccatactgggcatccttgtgtacaatgtt
gattttcctatctcgacgtttacgcaaaccttcttagtcgccattctgttcgggatcgga
acagattactgcattcttcttctgacccgattccgtgaagagttagcaaacgggcatgac
aaaaaagaagcggcgcttatcgcttaccgtacagggggaaaaaccttatttatcagcgga
tttgcggtattgatcggattttccgccttaggatttgcgaagtttgcgattttccaatcc
gcagtgggagtcgcagttggagtcggaattctaatgatcatcctctacacattgctgcca
ttatttatggtaacgctgggtgaaaaattattttggccttctaagaaagtgctgtcgcac
agtgacaacaaattatgggcgtttctcggcagatattccgttgtgcgtccgtttctgttt
attgtcatcacggtgattatcacgcttccgttcattttgacctatgatgaccagatttca
tttgattcgactgcggaaatcagcagcgattataaatcagtaaaagctctcgaggccatc
aaggatggattcggtgaagggaaagcgttcccgatcaatgttgtcgtgaaaggagacaag
gatctcacaacagctgatacaatcccttatctcggaaatatcagcaaagcgatcgagaaa
gtcgagcatgttgactctgtcatgaccatcacgcagccgactggtgaaaaaatcaaagat
ttatatattgataaacagctaggcacggtttcagacggactggataagacggtaaaagga
atcaccgatgtccaaagcggtttaacggatatagaaaacgggttgaatcaaatggcgggg
caaaccggctcagcctcaaatagcaggtccggcggttcactgggtgatgcggcagacgga
ttgggcaaaatcaatcagcagctgcagctcgtgagcaaacagatttcccaaaccggcaat
actgcgcagaccgtgcagcagcttacggcaatcagcggacagcttggacagattcaaacc
ggacttgaacaagcgaaccagcagctctcaggccagcaggcagaagctggaacgctgaca
gaaagcctgaagaagcttgccgggggcgtgaagagtgctaatgatggcctgacgaaaatc
tctgacggcattacagcttccagtgatatgttagaggacatgagcaaaagctcaaccgta
aggaatacaggcatattcattcctgatcaagtaatgaaggataaagactttaagaagtca
attgaccaatattcctttgcagacggcaaaggcgtgcaattaagcgtcgtcctggactca
aatccttattcagaacaagccattgcaacaataaaccaaatcaaaaaagctgtagcaaac
gaagttgacggcactcctctcgaggatgcacagatcgtatacggcggggtcacgagtgtg
aatgcagacttaaaagagctgtctacaacggacttctccagaacaatggtgatcatgatt
attggcctgtttatcgtgttaacgattttgttccgttcaatgatcatgccgatttatatg
atcgcgtcactgctgctgacgtactatacgtcgatatccataacagaattaatttttgta
aacggcttaggaaacgccggcgtcagctgggcagtaccgttcttcagctttgtcatcttg
atcgcgttaggcgtagattattcgatcttcctgctggaccgatttaaggaagaggtgcac
cttggcattgcgcaaggtgtcgtcagatcaatgagcaaaatgggatccgtcattattaca
gcggccattattttggccggaacgttcgcagcgatgatgccttcaggcgtcaatacgctg
atgcaggtggcaagtgtcattattatcgggctgctgctttacggccttgtcattcttccg
ctcttcattccggcaatcatcatgacctttggcgaaggcaactggtggccgtttggcagg
aagaaaatcaaagaataa

DBGET integrated database retrieval system