KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1139Help
Entry
GYO_1139          CDS       T01635                                 

Definition
(GenBank) glutamate-1-semialdehyde-2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00860  Porphyrin and chlorophyll metabolism
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GYO_1139
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bst01007]
    GYO_1139
Enzymes [BR:bst01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     GYO_1139
Amino acid related enzymes [BR:bst01007]
 Aminotransferase (transaminase)
  Class III
   GYO_1139
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AEP85814
UniProt: G4NRI4
Position
complement(1053947..1055125)
Genome map
AA seq 392 aa AA seqDB search
MEKANGAYFWDVDGNKYIDYLAAYGPIITGHAHPHITEAIKNAAENGVLYGTPTKHEVTF
AKMLKEAIPAMDKVRFVNSGTEAVMTTIRVARAYTGRTKIIKFAGCYHGHSDLVLVAAGS
GPSTLGTPDSAGVPKSIANEVITVPFNDIESYKAALDKWGSEIAAVLVEPIVGNFGIVEP
KEGFLEKVNELTHDAGALVIYDEVITAFRFMYGGAQDLLQVKPDLTALGKIIGGGLPIGA
YGGKKEIMEQVAPLGPAYQAGTMAGNPASILSGIACLEVLKEEGVYEKLDHLGAMLEEGI
LQHAETHGITITVNRLKGALTVYFSDEKVENYEQAERSDGKTFATFFKLMLERGINLAPS
KYEAWFITTAHTEQDIKDTLAAVEDAFKHLKN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaagcaaacggcgcttatttttgggatgtggacggcaacaaatacatcgattat
ttagcggcttacggtccgatcattaccggacatgcccacccgcatattacagaagcgatt
aaaaatgcagcagagaacggcgtattgtatggaacaccgacaaaacatgaggttacattt
gcaaagatgctcaaagaagccattcctgctatggacaaagtaagattcgtcaattcggga
acagaagctgttatgacgactatccgcgtggctcgcgcatatacaggccggacaaaaatc
attaaatttgcaggctgttaccacggacattcggatcttgtgcttgtcgccgccggttcc
ggcccatctactcttggcacaccagactcagccggtgtaccaaaaagcattgcaaacgaa
gtgatcacagttccatttaatgatattgaaagctataaagcggcccttgataaatggggc
agtgaaatcgcggcggttctcgtcgagccgattgtcggcaacttcggaattgttgagccg
aaagagggcttcttggaaaaagtaaatgaactgacacacgatgcgggcgctctcgttatt
tacgatgaagtcattacggctttccgctttatgtatggcggcgcgcaggatctgttacag
gtgaaaccggatttaacagcactcggaaaaattatcggcggcggacttccgattggcgcc
tatggcggcaaaaaagaaatcatggagcaggtagccccgcttggaccggcttatcaggcc
ggaacaatggccgggaaccccgcttccatcctatcaggcatcgcttgcctggaagtgctc
aaagaggaaggcgtgtatgaaaagcttgatcaccttggcgctatgctggaggaaggcatt
ttacagcacgcagaaacacacggcatcacgattactgtcaaccgcttaaaaggcgcactc
acggtttatttctctgatgagaaagtcgaaaattacgagcaggctgaacgcagtgacgga
aaaacattcgctacgtttttcaagttgatgctggaacgcggaattaatttagcaccttct
aaatatgaagcctggtttattacaacagcacatacagagcaagatattaaagacacgctc
gcagcggtcgaggatgcttttaaacatcttaaaaactag

DBGET integrated database retrieval system