KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1337Help
Entry
GYO_1337          CDS       T01635                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00071  Fatty acid degradation
bst00072  Synthesis and degradation of ketone bodies
bst00280  Valine, leucine and isoleucine degradation
bst00310  Lysine degradation
bst00362  Benzoate degradation
bst00380  Tryptophan metabolism
bst00620  Pyruvate metabolism
bst00630  Glyoxylate and dicarboxylate metabolism
bst00640  Propanoate metabolism
bst00650  Butanoate metabolism
bst00900  Terpenoid backbone biosynthesis
bst01100  Metabolic pathways
bst01110  Biosynthesis of secondary metabolites
bst01120  Microbial metabolism in diverse environments
bst01130  Biosynthesis of antibiotics
bst01200  Carbon metabolism
bst01212  Fatty acid metabolism
bst02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GYO_1337
   00630 Glyoxylate and dicarboxylate metabolism
    GYO_1337
   00640 Propanoate metabolism
    GYO_1337
   00650 Butanoate metabolism
    GYO_1337
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GYO_1337
   00072 Synthesis and degradation of ketone bodies
    GYO_1337
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GYO_1337
   00310 Lysine degradation
    GYO_1337
   00380 Tryptophan metabolism
    GYO_1337
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    GYO_1337
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GYO_1337
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    GYO_1337
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bst04147]
    GYO_1337
Enzymes [BR:bst01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     GYO_1337
Exosome [BR:bst04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   GYO_1337
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AEP85992
UniProt: G4NRT2
Position
complement(1222554..1223648)
Genome map
AA seq 364 aa AA seqDB search
MNAVIVDAKRTIFGKQNGLLKPFLPEDLAAPIISCLSRKLGDQIDEVILGNATGRGGNLA
RLSALQAGLPLSVPGMTIDRQCGSGLEAVRYACSLIQAGVGTMYIAGGSESSSQSPFSER
ARFSPNAIGDPDMGIAAEYTAARYSISRSMQDEYALLSHQRSRNAHDGGFYREEIVPLGE
LEMDEAFLKKRPIEAIISRAKPIFDTSSGTVTAANSSGISDGAAALLVMEEEKAAALGLK
PVLRFIGSAVSGIHPNYPPAAPVDAIRKLLTAHDVTPDDIDLYEINEAFAVKICVCSQEL
GIPFSKINVRGGALALGHPYGASGAALVTRLFYETQRRTDCQYAVAAIGSGGGIGLALLF
EVLA
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgaatgcggttattgttgatgcaaaacgaacgatctttggaaaacaaaatgggctgcta
aagccctttctaccggaggatttggcggctcccatcataagctgtctcagccgaaagcta
ggggatcaaattgatgaagtgattctcggaaacgcgaccggcagaggcggcaacctcgct
aggctgtcagctctgcaagccggactgcctttatcggttcccggtatgacgattgacaga
cagtgcggctccggccttgaagctgtgcgctatgcctgcagtctcattcaagccggagtc
ggcacgatgtatatcgcgggcggctcagaaagcagcagccaatcacctttttcagaacgg
gcccgcttttctccaaatgcgatcggtgatcccgacatgggcatcgcagccgaatatacg
gcagcacgctattccatcagcagaagcatgcaggatgaatacgcgcttctcagccatcaa
cgcagcagaaacgcgcatgatggaggattttaccgtgaagaaattgttcctctcggcgaa
ttggagatggatgaagcatttctgaaaaagcggccgatagaagcgattatttcccgtgca
aaaccgattttcgacaccagctccggaacggttacagcagccaacagcagcggcatatca
gacggagcggccgctctccttgtaatggaagaagaaaaagctgcagccctagggcttaag
ccagtgctccggtttatcggcagtgctgtcagcgggattcacccgaactatccgcccgcg
gcgccggttgatgcgatccggaagcttttaactgcacacgatgtaacacctgatgatatc
gatttatatgagatcaatgaagcctttgccgtcaaaatttgtgtctgctcgcaagaactc
ggcatccccttttcaaaaatcaatgtgcgcggcggcgcattagctctcggccatccgtac
ggcgcatcgggtgcagctctggtaaccagattgttttatgaaacgcaaagacggacagac
tgtcaatatgccgttgcggccatcggaagcggcggcggaatcggactggctttattattt
gaagttcttgcatag

DBGET integrated database retrieval system