KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_1472Help
Entry
GYO_1472          CDS       T01635                                 

Gene name
thiO
Definition
(GenBank) glycine oxidase ThiO
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00730  Thiamine metabolism
bst01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    GYO_1472 (thiO)
Enzymes [BR:bst01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     GYO_1472 (thiO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 FAD_binding_2 Pyr_redox_3 Pyr_redox_2 HI0933_like FAD_oxidored Pyr_redox 2-ph_phosp ApbA 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: AEP86124
UniProt: G4NWG9
Position
1353866..1354975
Genome map
AA seq 369 aa AA seqDB search
MKRHYDAVVIGGGIIGSAIAYHLAKENKNIALFESGTMGGRTTSAAAGMLGAHAECEERD
AFFDFAMHSQRLYKGLGEELYTLSGIDIRQHNGGMFKLAFSEEDVQRLRKMDDLDSVSWH
TKEEVLEKEPYTSGDIFGAAFIQDDVHVEPYFVCKAYAKAAKALGAEIFEHTPVLHVDRD
GEALSIETPNGNVWADHVAVASGVWSGMFFKQLGLNNSFFPVKGECLSVWNDDIPLTKTL
YHDHCYIVPRKSGRLVVGATMKPGDWSETPDLGGLELVMKKAKTMLPAIQNMKVDRFWAG
LRPGTKGGKPYIGRHPEDSRILFAAGHFRNGILLAPATGALIGDLMMNKEVNQDWLHAFR
IDRKEAVQI
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggcattatgatgcagttgtcattggaggcggaattatcggttccgcgattgct
tatcatttagcaaaggaaaacaaaaacatcgcattgtttgaaagtggaacaatgggcggc
agaacaacaagtgctgctgccggaatgctgggcgcccatgccgagtgcgaggaacgtgac
gcgttttttgactttgccatgcacagccagcgtttgtacaaaggtcttggagaagagctt
tacacattatccggtattgatatcagacagcataacggcggtatgtttaagcttgcgttt
tctgaagaagacgtgcagcggctgaggaagatggatgacttggattctgtcagctggcat
acaaaagaagaagttttagaaaaagagccgtatacgtctggtgacattttcggggcagcc
tttattcaagatgatgtgcatgttgaaccttattttgtttgtaaggcatatgcgaaagca
gcgaaagcgcttggggcggagatttttgagcatactcctgtcctgcatgtcgaccgtgac
ggtgaagcgctgtccatcgagacgccgaatggtaacgtatgggcggatcatgtcgcggtt
gccagcggggtgtggagcggaatgttttttaaacagcttgggctgaacaattcatttttc
cctgtaaaaggggagtgcctgtctgtttggaatgatgatataccgctgacaaaaacactt
taccatgaccattgctatatcgtaccgagaaaaagcggcagactggttgtcggcgcgaca
atgaagccaggtgactggagtgaaacaccggatcttggcggattggaattggtaatgaaa
aaagcaaaaacgatgctgccggccattcagaatatgaaggtggatcgtttttgggcagga
ctgcggccgggaacaaagggtgggaaaccgtacatcggcagacaccctgaggacagccgt
attttatttgcggcgggccatttcagaaatgggattctgctcgctccggcaacgggcgct
ttgatcggtgatctcatgatgaataaagaggtcaatcaagactggctgcacgcattccga
attgatcgcaaggaggcggttcagatatga

DBGET integrated database retrieval system