KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3103Help
Entry
GYO_3103          CDS       T01635                                 

Definition
(GenBank) long-chain-fatty-acid--CoA ligase
  KO
K01897  long-chain acyl-CoA synthetase [EC:6.2.1.3]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst00061  Fatty acid biosynthesis
bst00071  Fatty acid degradation
bst01100  Metabolic pathways
bst01212  Fatty acid metabolism
bst02024  Quorum sensing
Module
bst_M00086  beta-Oxidation, acyl-CoA synthesis
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    GYO_3103
   00071 Fatty acid degradation
    GYO_3103
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GYO_3103
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bst01004]
    GYO_3103
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bst04147]
    GYO_3103
Enzymes [BR:bst01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     GYO_3103
Lipid biosynthesis proteins [BR:bst01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   GYO_3103
Exosome [BR:bst04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   GYO_3103
  Exosomal proteins of breast cancer cells
   GYO_3103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AEP87706
UniProt: G4NYS8
Position
complement(2864623..2866302)
Genome map
AA seq 559 aa AA seqDB search
MQSQKPWLAEYPDDIPHELPLPNKTLQSILTDSAARFPDKTAISFYGKKLTFHDILTDAL
KLAAFLQGNGLQKGDRVAVMLPNCPQAVISYYGVLFAGGIVVQTNPLYTEYELEYQLRDA
EASVIITLDLLFPKAIKMKTLSIVDQILITSVKDYLPFPKNILYPLTQKQKVHIDFDRKD
HIHMFASSMKEEKTELLTIPKIDPEHDIAVLQYTGGTTGAPKGVMLTHQNILANTEMCSA
WMYDVKEGAEKVLGIVPFFHVYGLTAVMNYSIKLGFEMILLPKFDPLETLKIIDKQKPTL
FPGAPTIYIGLLHHPELQHYDLSSIKSCLSGSAALPVEVKQKFEKVTGGKLVEGYGLSEA
SPVTHANFIWGKNKPGSIGCPWPSTDAAIYSEEMGKHAAPYEHGEIIVKGPQVMKGYWNK
PEETAAVLRDGWLFTGDMGYMDEEGFFYIADRKKDIIIAGGYNIYPREVEEALYEHEAIQ
EIVVAGVPDSYRGETVKAFVVLKKGAKADAEELDTFARSRLAPYKVPKAYEFRKELPKTA
VGKILRRRLLEEAENHHVK
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgcagtctcaaaagccgtggcttgccgagtatcccgacgatatcccgcatgagcttcca
ttgccgaacaaaaccctgcaatccatcctgacagactccgccgcacgattccctgacaaa
accgcaatatctttttatggaaaaaaactcacctttcatgacattctgacggatgctctt
aaactcgcagcttttttgcagggcaatggcctgcaaaaaggagacagagtggctgtcatg
ctgcccaattgcccgcaagcagtgatttcttattatggcgttttgtttgccggtggcatc
gtggtgcagacgaatccgctctataccgagtacgagcttgaataccagctgagagatgct
gaggcgagcgtgatcatcaccttagatttgcttttcccaaaggcaataaaaatgaaaacg
ttatcaattgtagatcagattttgatcaccagcgtaaaagattatttgccttttccgaag
aatattctttacccgctgacgcaaaaacaaaaagtgcacatcgactttgacagaaaagat
cacattcacatgttcgcttccagcatgaaggaggaaaaaactgagctcctgacaatcccg
aagatcgatcctgaacatgatatagctgtcctccaatataccggaggaacaacgggggct
ccaaaaggagtcatgctcacgcaccaaaatattttggccaatactgaaatgtgctccgct
tggatgtacgatgtgaaggaaggggctgaaaaagtgcttggcatcgtcccgttttttcat
gtctacggactgacggcagtgatgaattattcgattaaactaggcttcgaaatgattctt
cttcctaagtttgatccgctcgaaacgctcaaaatcatcgacaaacaaaaaccgacgctc
tttccgggcgcaccgacaatttacattggccttttgcatcaccccgaattgcagcattat
gatctgtcatccattaaaagctgtcttagcggatcagccgcactgcctgtggaggtaaag
cagaaatttgaaaaggtaactggcggaaagcttgtggaaggctacggcttgtctgaggca
tccccagtgacacatgccaattttatctgggggaaaaacaagccaggcagtattggctgt
ccttggccgagtactgacgccgcgatctattcggaagagatgggtaagcatgccgctcca
tatgagcatggagaaatcattgtaaaaggtccgcaagtcatgaaaggatattggaacaaa
ccggaggaaactgccgctgtactgagagacggctggctgttcaccggcgacatgggctat
atggatgaagagggctttttctatattgccgacaggaagaaggacatcatcattgccggc
ggctacaatatttacccgcgtgaagtagaagaagcgctttatgaacatgaagccatccag
gaaattgtggttgccggtgtgcctgattcctatagaggagaaacagtaaaagcatttgtc
gtgttaaagaaaggcgcaaaagctgatgcagaagaactggacactttcgcgagatcccgc
ctcgctccctacaaggtgccgaaagcctatgagttcagaaaagagctgccgaaaacggca
gtcggaaaaattttaagaaggcgtttacttgaagaagccgaaaatcatcatgtcaaataa

DBGET integrated database retrieval system