KEGG   Bacillus subtilis subsp. spizizenii TU-B-10: GYO_3489Help
Entry
GYO_3489          CDS       T01635                                 

Definition
(GenBank) 2,3-dihydroxybenzoate-AMP ligase
  KO
K02363  2,3-dihydroxybenzoate-AMP ligase [EC:6.3.2.14 2.7.7.58]
Organism
bst  Bacillus subtilis subsp. spizizenii TU-B-10
Pathway
bst01053  Biosynthesis of siderophore group nonribosomal peptides
bst01110  Biosynthesis of secondary metabolites
bst01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bst00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01053 Biosynthesis of siderophore group nonribosomal peptides
    GYO_3489
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:bst01008]
    GYO_3489
Enzymes [BR:bst01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.58  (2,3-dihydroxybenzoyl)adenylate synthase
     GYO_3489
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.14  enterobactin synthase
     GYO_3489
Polyketide biosynthesis proteins [BR:bst01008]
 Nonribosomal peptide synthetase (NRPS)
  Iterative NRPS
   Enterobactin synthetase
    GYO_3489
   Bacillibactin synthetase
    GYO_3489
  Nonlinear NRPS
   Vibriobactin synthetase
    GYO_3489
   Myxochelin synthetase
    GYO_3489
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C SAP
Motif
Other DBs
NCBI-ProteinID: AEP88066
UniProt: G4P087
Structure
PDB: 

Position
complement(3230654..3232273)
Genome map
AA seq 539 aa AA seqDB search
MLNGFTPWPEELAETYRKNGCWAGETFGDLLRDRAAKHGDRIAITCGNTHWSYQELDTRV
DQLAAGFQKLGIQQMDRVVVQLPNIAEFFEVIFALFRLGALPVFALPSHRSSEITYFCEF
AEAAAYIIPDSYSGFDYRSLARQVQSKLPSLKHVIVAGEAEEFLPLEALHTEPVKLPEVK
SSDVAFLQLSGGSTGLSKLIPRTHDDYIYSLRRSAEVCWLDHSTVYLAALPMAHNYPLSS
PGVLGVLYAGGRVVLSPSPSPDDAFPLIEREQVTITALVPPLAMVWMDAASSRDDNLSSL
QVLQVGGAKFSAEAARKVKAVFGCTLQQVFGMAEGLVNYTRLDDPEEVIVNTQGKPMSPY
DEVRVWDDQDRDVKPGETGHLLTRGPYTIRGYYKAEEHNAASFTEDGFYRTGDIVRLTSD
GYIVVEGRAKDQINRGGEKVAAEEVENHLLAHPAVHDAAMVSMPDQFLGERSCVFIIPRD
EAPKAAELKAFLRERGLAAYKIPDRIEFVESFPQTGVGKVSKKALREAIAEKLLAGSKK
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgctgaatggatttactccttggcctgaagagttagctgagacatatcggaagaacggc
tgctgggcgggcgagacgtttggagatttgttaagggaccgggctgctaaacatggcgat
cgcattgcaattacatgcggaaacacccattggagctatcaggagcttgacacaagggtt
gatcaactggctgccggttttcagaagctcggcattcaacagatggatcgtgtcgtggtg
cagctgccgaatatcgcagagttttttgaagtcattttcgcactcttccgtttgggggcg
cttccggttttcgcactgccttctcatcgaagcagtgaaattacatatttttgcgagttt
gctgaagcggctgcttatattattcccgactcctattccggttttgactaccgttcactt
gccagacaggttcaaagcaaactgccatctttaaaacatgtcattgttgcaggtgaggca
gaggaatttttgccactggaggctttgcatacagaacctgtaaaactacctgaagtcaaa
tcttctgatgtggcgttccttcagctttctggaggaagcaccggcttatcaaaactgatc
ccgcggactcacgatgactacatatacagtctgcggcggagtgcagaggtttgctggctc
gaccacagcacggtgtacttggcagcattgccgatggcgcataattatccgctgagctcg
cctggagttctcggcgtgttatacgccggaggaagagtggtattatctccttctccaagt
cctgatgacgcatttcctttgattgaacgtgaacaagtcacaattaccgctcttgttccg
ccccttgcaatggtatggatggatgcggcatcctcacgcgatgacaatctatccagcctt
caagttctgcaggtcggcggcgccaagttcagtgctgaagctgcgcgcaaggttaaagct
gttttcggatgcacgctgcagcaggtgttcggaatggcagagggtctcgtcaattatacg
agactggatgaccctgaggaagtcattgtcaacacccaaggaaaaccgatgtccccatat
gatgaagtacgtgtttgggatgatcaggatcgtgacgtaaaacctggtgaaacagggcat
ctgctgacacgggggccgtacacgattcggggttactataaagcagaagagcacaatgct
gcttcttttactgaggacggtttttaccgcacgggtgatatcgtcaggctgacatcagac
ggctatattgtcgttgaaggcagggcgaaggatcaaattaaccgcgggggagaaaaagtg
gcggctgaagaggtagaaaatcatcttctggcgcatccggctgtccatgatgccgcaatg
gtctcaatgcctgaccaatttcttggcgaaagatcttgtgtgttcattattccccgggat
gaagccccgaaagccgcagagctcaaagcttttttgagagagcgcggactggcggcatac
aaaatccccgatcgcattgaatttgtcgaatcctttccgcagacaggggtaggaaaagtc
agcaaaaaagcgcttcgtgaagccattgccgagaagcttcttgcaggatcaaaaaaataa

DBGET integrated database retrieval system